KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08895Help
Entry
AMBLS11_08895     CDS       T02260                                 

Definition
(GenBank) putative succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00020  Citrate cycle (TCA cycle)
amk00190  Oxidative phosphorylation
amk00650  Butanoate metabolism
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01130  Biosynthesis of antibiotics
amk01200  Carbon metabolism
Module
amk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBLS11_08895
   00650 Butanoate metabolism
    AMBLS11_08895
  Energy metabolism
   00190 Oxidative phosphorylation
    AMBLS11_08895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Na_Ala_symp
Motif
Other DBs
NCBI-ProteinID: AFT78360
UniProt: K0D0Y1
Position
2100783..2101130
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLATLVAVMIHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYLAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcattaagcgtgacggcgtacaagactacgtttcacttcgc
gctacagcagcaattattttcgcgtactcggttttcatggcgtggtttttcattaccacc
gataacctaacgtttatcgaatggcgaggattgttctctggcctagctatgaaagttttc
acattggcaacactagtagcggtgatgatccacgtgcgcatcggcctttggcaggtgctt
acagactatgttaaatcagcaggtctgcgcgcaggactacaatatatcttaaatatcatc
gcattcggctatttagctgttggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system