KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08895Help
Entry
AMBLS11_08895     CDS       T02260                                 

Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_08895
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBLS11_08895
   00650 Butanoate metabolism
    AMBLS11_08895
  Energy metabolism
   00190 Oxidative phosphorylation
    AMBLS11_08895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2100783..2101130
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLATLVAVMIHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYLAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcattaagcgtgacggcgtacaagactacgtttcacttcgc
gctacagcagcaattattttcgcgtactcggttttcatggcgtggtttttcattaccacc
gataacctaacgtttatcgaatggcgaggattgttctctggcctagctatgaaagttttc
acattggcaacactagtagcggtgatgatccacgtgcgcatcggcctttggcaggtgctt
acagactatgttaaatcagcaggtctgcgcgcaggactacaatatatcttaaatatcatc
gcattcggctatttagctgttggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system