KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08915Help
Entry
AMBLS11_08915     CDS       T02260                                 

Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_08915
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBLS11_08915
  Amino acid metabolism
   00310 Lysine degradation
    AMBLS11_08915
Enzymes [BR:amk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMBLS11_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2106635..2108146
Genome map
AA seq 503 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGEIL
NEEGATVLGEQVIAKLEKGGAAAPAEAKAESKAKDDSKSDAAPAASGKTSDVKVPVLPES
VADATIATWHVAVGEAVSRDQNLVDIETDKVVLEVVAPADGSLAEILAEEGATVTAEEVI
AKFVEGAASGASAPAASSDNDDSDDSSDALSPSVRRLLAEKGVDAAKVKGTGKNGRITKE
DVEKYLKGGESSAKAAPASTESVSAELPTGNRTEKRVPMTRLRKTIANRLLEAKNSTAML
TTFNEVNMKPIMDLRKQYQDSFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIV
YHNYFDVSIAVSTPRGLVTPVLKDTDTLGMAGVEKGIKELALKGRDGKLSLAELQGGNFT
ITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGK
ESVGFLVTVKEMLEDPTRLLLDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggttctacctgagtcagttgccgatgccaccattgca
acctggcacgtaaaggccggtgacgcagttaaacgagaccagaacctggttgatattgaa
actgataaagtggttttagaagttgtggcgccagcggacggtacaattggtgagatccta
aacgaagagggtgcaactgttttaggcgaacaagtgattgctaaactagaaaagggcggt
gctgctgcaccggctgaagctaaagcagaaagcaaagcaaaagacgattcaaaatcagac
gcggcaccagcggcttctggtaaaacttctgatgttaaagtgccagtacttccagagtct
gtagctgacgcaactatcgctacatggcacgttgctgtaggtgaagctgtttctcgcgac
caaaacctggttgatatcgaaactgataaagtcgtacttgaagttgtggcaccagcagac
ggctctcttgctgaaattcttgcagaagaaggcgctacggtaacggctgaagaagtaatt
gcaaaatttgtagaaggtgctgcaagcggcgcttctgctccagcggcatcaagcgataac
gacgacagtgacgacagcagcgatgcgcttagtccatcagtacgtcgtttacttgctgaa
aaaggcgttgacgcagctaaagtgaaaggtacaggtaaaaacggccgtatcactaaagaa
gacgtagaaaagtaccttaaaggtggcgaaagctcggcaaaagctgcacctgcttcaact
gaatctgtatcagcagaattgccaacgggtaaccgtacagagaagcgtgttccaatgacg
cgtcttcgtaagactattgctaaccgtcttctagaagcgaagaactctacggcaatgtta
actacgtttaacgaagttaacatgaagccaattatggatctacgtaagcagtatcaagac
agcttcgagaagcgtcacggtattcgtcttggtttcatgtctttctatgtgaaagcggta
accgaagcacttaaacgtttccctgaagttaacgcgtcaatcgacggtgatgacattgtt
tatcacaactacttcgacgtatcgattgctgtttctacaccgcgtggccttgtgacacca
gtacttaaagatactgacacactaggcatggcaggtgttgaaaaaggaattaaggaacta
gcacttaaaggccgtgacggtaagctgtcattggctgaactacaaggtggtaatttcaca
atcaccaacggtggtgtgtttggttcactaatgtctacaccaatcattaacccgccacag
agcgctatcttgggtatgcataaaatccaagaccgcccaatggctgttaatggcaaagta
gaaattctaccaatgatgtacctagcgctttcttatgaccaccgtattatcgatggtaaa
gaatcagtaggtttcttggtaaccgttaaagagatgctagaagatccaacacgtctactt
ctagacgtataa

DBGET integrated database retrieval system