KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08920Help
Entry
AMBLS11_08920     CDS       T02260                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_08920
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBLS11_08920
   00640 Propanoate metabolism
    AMBLS11_08920
   00660 C5-Branched dibasic acid metabolism
    AMBLS11_08920
Enzymes [BR:amk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMBLS11_08920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108299..2109465
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFKEYGLPVSEGYAADTAQGAVEAADRIGGNEWVVKCQVHAGGRGKAGGV
KLVKNKDDIRAFAENWLGKNLVTFQTDENGQPVSKILVESCTDIANELYLGAVVDRTTRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPIVGPQPYQAREMAFKLGLSGVQIKQFTQI
FLGLAKMFEELDVALIEINPLVIKTDGNLHCLDAKVGIDGNALYRQPKLKDMQDPSQEDA
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LANSGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaaggtaagcagctattcaaagaatacggtttgcctgtttct
gaaggatacgcagcagacactgctcaaggtgctgtagaagccgctgaccgaattggcgga
aacgagtgggtagttaagtgtcaggtacacgcgggcggtcgcggtaaagctggcggtgta
aagctagttaaaaacaaagacgacattcgcgctttcgctgaaaactggcttggcaaaaat
ttggtgactttccagactgacgaaaacggtcagcctgtgagcaaaatcctagtagaatct
tgcacagatatcgctaacgagctttaccttggtgcagtagttgaccgtacaacccgtcgc
gttgtattcatggcttctactgaaggtggcgttgagattgaaactgttgcagaagagact
ccagaaaaaatccttaaagctgaaatcgacccaattgttggtcctcagccttaccaagca
cgcgaaatggcgtttaaacttggtctttctggcgttcaaatcaagcaattcactcaaatt
ttccttggcctagctaagatgtttgaagagcttgacgttgccctaatcgaaattaacccg
ctagttatcaaaactgacggtaacctacactgcctagacgcaaaagtaggtatcgatgga
aacgcgctttatcgtcagcctaagctgaaagatatgcaagatccttcacaagaagatgcg
cgtgaagctcacgcagctcagtgggaactaaactacgtagcactagacggtaacgtaggt
tgtatggttaacggtgcaggcctagcaatgggtaccatggacatcgtaaacctacacggt
ggtaagccagctaacttcctagacgttggtggtggtgcaactaaagagcgtgttgctgaa
gcatttaaaatcatcctttctgatgacaatgttaaagcggtattggttaacatcttcggt
ggtatcgttcgttgtgacatgatcgctgaaggtattatcggtgcagttaaagaagttggc
gttaaagtgccagttgttgtgcgccttgaaggtaccaatgcagaacttggccgtgaggtt
ctagcgaactcaggtcttgatatcatcgctgctgaatcgctaactgatgcagcacagaaa
gttgttgctgcagcggagggcaaataa

DBGET integrated database retrieval system