KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_09135Help
Entry
AMBLS11_09135     CDS       T02260                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_09135
   01230 Biosynthesis of amino acids
    AMBLS11_09135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBLS11_09135
   00030 Pentose phosphate pathway
    AMBLS11_09135
   00051 Fructose and mannose metabolism
    AMBLS11_09135
   00052 Galactose metabolism
    AMBLS11_09135
  Energy metabolism
   00680 Methane metabolism
    AMBLS11_09135
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AMBLS11_09135
Protein phosphatases and associated proteins [BR:amk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AMBLS11_09135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169608..2170612)
Genome map
AA seq 334 aa AA seqDB search
MSKRVAILTSGGDAPGMNACIRATIIACQKAHFTLLGYKHGYNGLLQQEYISLSLDSTHN
LIQQGGTILHSARCKEFKQTEGLVKAAENLTQANIDTLIVIGGDGSFRGASKLSEHWNGQ
IIGIPGTIDNDIAGTDATIGYYTAIDTAMSSIDKVRDTADAFERIFLVEVMGRNAGFLAL
NAALSSAADYVVVPEFFTSAEAEIQKIVKQIKAQRRLKGPVSFIVVVAENVWPNGLLGLT
EALQQYDINDVRPVTLGHVQRGGSPVAQDRLLATTLGEFAISLVGKDVTNVMVGEVNQRP
VTVPLSDTWENTKQLNEARVDAMRTLMNERYRSE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaacgtgtcgctatattaacgtctggcggagatgcgccaggaatgaacgcctgt
attcgcgccacaattattgcgtgtcagaaggctcacttcaccttgcttggatataaacat
ggttacaatggtctactccagcaagagtacatttcgctatccctcgactcgacccataac
cttattcaacagggcggcactattttacatagtgcacgatgtaaagaatttaaacagact
gaaggactggttaaagcagctgaaaacttaacacaagcaaatattgatactctgattgtc
attggtggtgacggttcgtttcgaggagcgtcaaagttgagtgaacattggaatggtcaa
atcatcggtatacccggcaccattgacaatgatatagctgggacagacgcaaccattgga
tattacactgctatagacactgcgatgagctctatagacaaggttcgagatacggcagat
gcttttgagagaatttttcttgtagaagttatggggcgcaacgctgggttcttagcgctt
aatgcagcgctgtcttccgcagcagactatgtggtggttccagagttcttcacgtcggct
gaagctgaaatacaaaaaatagtgaagcaaataaaggcgcaaagacgattaaaaggacct
gtcagtttcattgtggtagtggctgaaaacgtatggccaaacggtttgttgggcttaact
gaagcgctgcagcaatatgatattaatgacgtacgaccggtaaccttaggtcacgtacaa
cgcggtggttcaccggtagcacaagaccgcttacttgccactacactaggcgaattcgct
attagtttggtaggcaaagatgtaacgaacgttatggttggtgaagtgaaccagcgccct
gtaaccgtacccctgtcagacacctgggaaaacaccaagcagctcaacgaagctcgtgta
gacgccatgcgtacgcttatgaacgaacgatatcgtagcgaatga

DBGET integrated database retrieval system