KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_10070Help
Entry
AMBLS11_10070     CDS       T02260                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMBLS11_10070
Enzymes [BR:amk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     AMBLS11_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2389678..2391432
Genome map
AA seq 584 aa AA seqDB search
MAWDLLHDKVKHHLESIYADVTLDVSYETLATELMNTIGIQQQTDIASPQSHHNYWDEDD
IIMITYGDSVIDEGERPLVTLNKFLHRYCKNTVNNVHILPFFPYSSDDGFSVIDYSTVNE
ALGSWDDIEVIAKDYGLMTDLVINHCSARSVWFDNFVKGEGPGSDFFFTADPSDDLSMVT
RPRVSPLLRETETANGTKYVWCTFSHDQVDFDFRNPKVLLAFIDIIKLYIDKGAKIFRLD
AVAFLWKIVGTNCINLFQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVTGDCTYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLS
DEEISELVHTMQHFGGKVSWRASDHGQQKPYEINITLFDALQGTTKGPDKYQVDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRKRWDFNELEALLDSPFSQHHKV
LTRISQLIRIRKAQPAFHPNATQFTLHLGNQLFGYWRQSLDRKQGIFCISNISDEEQTVL
LSDINLIGTDNWIDLISRESISLSSPFIQMKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggaccttctccatgacaaagtaaagcaccatttagaaagcatttacgctgat
gtaacgctagacgtctcgtatgagacgttagcgactgagttaatgaacaccataggcatt
caacagcaaacggatattgcttcacctcagtctcatcacaattattgggatgaagacgac
attatcatgattacttacggtgatagtgtgattgatgagggagagcgccccttagttaca
ttaaataaatttttgcatcgctactgcaagaataccgttaacaatgtgcatattttgccc
ttctttccatacagttcagatgacggtttttccgtcatagactactccaccgtgaatgaa
gcgttggggtcatgggatgacatagaagttattgccaaagattatgggctaatgaccgat
ttggttatcaatcactgttcggcgagaagtgtttggtttgacaactttgttaaaggcgaa
gggcccgggtcagattttttctttacagcagatccgtctgacgacctttctatggtaacg
cggcctcgcgtatcgcccttacttcgcgaaacagagaccgcaaatggcacaaagtacgta
tggtgtacctttagtcacgaccaggtagattttgactttagaaaccccaaagtactgtta
gcgtttatcgatatcatcaagctgtatattgataaaggcgccaaaatctttcgcttagac
gcagtggcgttcctttggaaaattgtcggaacaaactgcattaacttgttccaaacccat
gaagttattcgtttgatcagaacgctgattgaacatgtggatccatcaatcataatcatt
accgaaaccaatattcctaaccgggagaacctgacctattttggtaatgccaatgaagcc
catgctatctacaacttttcactaccgccattgcttgtaaataccttagtaacaggtgac
tgtacgtatttgaaaagttggatgatgagtatgccaccagcacaaaacggtacagcatat
ttcaatttcattgcttctcatgacggtataggtctgcgcccggcagaaggcttgctgtca
gatgaagaaatttcagaactggtgcacacaatgcagcatttcggcggtaaagtttcttgg
cgagcatcggatcatgggcagcaaaagccttatgaaataaacattaccctattcgacgcg
cttcaaggcactacgaaaggcccggataaataccaggttgaccgttttatttgtgctcac
gccattatgttaggcatggaaggtatcccaggaatttatatacatagcttgctgggcact
tcaaatgattacgagaaagtcgcaaatacagggcaaaatcgctcgataaatagaaagcgc
tgggactttaatgagctcgaagcgttgttagactcccccttctcacaacatcacaaagta
ctcacgcgcatttctcagttaattcgaattcgtaaagcgcagcctgcattccatccgaat
gcgacacaatttacgctgcacttgggaaatcagttatttggttattggcgacaaagttta
gatcgtaaacaaggcatattttgtatcagcaatatttcagatgaagagcaaacggtactg
ctgtcagacataaacttaataggtacggacaattggatagatcttatctctagagagagc
atatccttgtctagccctttcatacagatgaaaccataccaagttctgtggatcagcaac
caagattttgaataa

DBGET integrated database retrieval system