KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_10795Help
Entry
AMBLS11_10795     CDS       T02260                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2535050..2537275)
Genome map
AA seq 741 aa AA seqDB search
MNNNQDSVSSFFDNLFGIEAIDKFVAKEFGFVDELEQEDRLIWAGVLAYLSYMQRNGHSC
IYLKEIAGTTLFKEVVAEQEPVLATETNEHNSNGTVGASKSPVEQTEPEKAPKPGFDVPQ
LTQLLRIVKSALVNAQVAQLFVYNNGKLYSRRYYEFEQEVASNVVKRAALTPLSGEASEK
VKQLWPAIFPTETTDQQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQACDEN
LKIVLAAPTGKAQQRMTESIMNSIDGLRGKLDDTVLNNVPTDAVTLHRLLVLREHGVSTK
YNQHNQLSADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLEQLV
SDGAASFGANENAALNGTVSVHSSLSLGGHDNALSLGGVPSLMRQHIATLCPHLPLLPVN
EQAKSYVATLQAPQRFKGQVAKVATAIQRGDASGALAAINDRADANDESAKPASSIASRL
QPGVHLWPEHQVSGRDLHQLAKESFLPIFDAGSAEEALNRLNVVRWLTPIRKGTMGVEGL
NSLVFDAIKHKIRKREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDNKGKLYAWFYQDS
QGTGQKAPLGSGDSGDELLSQKQLNQGQTQQEQKQALRSISLSRVPQFETVYAMTIHKSQ
GSEFNQVVLILPKPDSDKAANLFHRGLVYTGLTRAKDGCLIISDNATFSHMVQRVDKRYS
GLSEAISHHLEDNSHASPETK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaatcaagattccgtatcgtcattttttgataacttgtttggcattgaggct
atcgacaagtttgtcgcaaaagaatttggctttgttgacgaactagaacaagaagacagg
cttatctgggctggggtcttagcgtatttgtcttatatgcagcgcaatggccacagctgt
atttatcttaaagaaatagcgggtacaacgctttttaaagaggtagtagcagaacaagag
ccggtcttggcgaccgagacgaatgagcacaacagtaacgggacggttggcgcatctaag
tcaccagtagaacaaacagagccggaaaaagcgcccaaaccaggtttcgacgtgccacaa
ctaacgcaattacttagaattgtaaaaagcgcgctggttaacgcgcaggtggcacaacta
tttgtttataacaacggcaagctgtacagccgtcgctactatgagtttgaacaagaagtt
gcgagcaatgtggtaaaacgagctgcgcttacgcccttaagtggtgaggcaagcgaaaaa
gtaaaacaactttggcccgctatctttcctactgaaacaaccgatcagcaagactggcag
caaattgcggtggcgaaaagcctgatgcagcgcttttgtgttataaacggtgggccagga
acaggtaaaacctatacagtattgcgtttattactggcgctacaggcttgcgatgaaaac
ttaaaaattgtgctggcggcgcctacaggtaaagcgcaacagcgtatgaccgaatctatc
atgaatagcatagacgggcttcgcggcaagttggacgacacagtgcttaacaatgtgcct
accgatgctgtgacgctgcatagattactagtgttgcgggaacacggtgtatcgactaaa
tacaaccagcacaatcagttgtcggcagatgtactcattgtcgatgaagcaagtatggtt
gaccttgcgctaatgacgcgcatagtgcgtgcattgccagaccatgcgcggctctatttt
atcggtgatgctgatcagcttcctgcggttgagcttggtaacgtgctagagcagctggtt
agtgacggggctgcaagctttggcgcaaacgagaatgctgctttaaacggcacagtcagc
gtgcatagctcacttagtttaggtggccatgacaacgcgctttctttaggtggtgtgcca
tcgttaatgcgacagcatatcgctacgctgtgcccacatttacctctgttaccggttaac
gagcaggcaaaaagctatgtagcaacactgcaggcaccgcagcgctttaaagggcaggtg
gccaaagttgcaacggccatacagcgaggtgatgcgagcggcgcacttgctgcaattaat
gaccgggctgatgctaatgatgaaagcgcaaagccagcttcaagtattgcttcacgactt
cagccgggtgtgcatttgtggccggaacaccaagttagcggtcgtgatttgcatcaactg
gccaaagaaagcttcttgcctatttttgacgcaggcagcgctgaagaggcgcttaatcgc
ttgaatgttgttaggtggctaacaccaattcgcaaaggcacaatgggcgtagaagggcta
aatagtttggtgttcgatgctattaagcacaagatcagaaagcgggaagggcacttttat
caaggccagcccatcatgattgtaaagaatcatcaccctcagcgactatcaaacggcgag
gttggcgtaatctggccagacaataagggaaagctttatgcgtggttttatcaagatagc
caaggaacaggacaaaaagcaccgctaggttcaggagatagtggggatgagcttttaagt
caaaagcagctaaatcagggccagacacaacaggagcagaagcaagcgttacgcagcatt
tcgctttcaagagtgccacagtttgaaactgtttacgccatgaccattcacaaatcgcag
ggctctgaatttaatcaggttgtactcatcttgccaaaacctgatagcgataaagctgca
aacctctttcaccgagggttagtgtatacaggattaacccgtgccaaagacggctgttta
atcatttcagataacgctacattcagccacatggttcaacgggtggataagcgttattct
gggttgtccgaggcgattagtcatcatcttgaggataattctcacgccagcccagaaact
aaataa

DBGET integrated database retrieval system