KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_11000Help
Entry
AMBLS11_11000     CDS       T02260                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMBLS11_11000 (malQ)
Enzymes [BR:amk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AMBLS11_11000 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2587090..2589288)
Genome map
AA seq 732 aa AA seqDB search
MTQQLLQQLVEMRGIETQYVDAWGKPATIAESSKAKLLNTLGYDTSSDEKIQSQITQDIK
SVWLSPLNPVQVVRNTQEINVAVRLPIELVNDDHVLTITCENGDVLTHQFTPVDQEMTTM
AHIDDVEFHEYVVTLPLDLPLGYHDVALSADNDEFARSRLIVAPEACYTPNEIKEGKKIW
GLSVQLYCVRSEKNWGIGDFSDLALLIEKAAGVGADFIGLNPIHALYPANPNACSPYGPS
SRRWLNYLYINVTAIDGYDDASVQAVVNSDEFKATLDHARNVEHVDYEAVAHLKLAALKA
VFDVYDAKYLRKSTKQNKAFKAFVEAGGESLDMLAVYDALQSHLKAEGKDSWGWPVFPQE
YKDYHNPAVAKFKSANEQDVKFYLFLQWIAAQQLELASSKATDAGMTIGLYRDLAVGVSE
GSAEIWGNKDLYCTGASVGAPPDILGPLGQNWGLPPMDPRKLYEQGYQPIIDLFASNMAS
SGSLRIDHVMALLRLWWVVKGDNAKDGGYVYYPVDDLLGILALESHRNQSLVIGEDLGTV
PEEIRSKLADNGVYSYRVFFFEQAEDGGFFSPSHYPVQSMSTLTTHDMPTLIGYWHCLDL
ELGKEIGLYPTEEILQTLYADRHENKQAILDTLHGHGSIGDNVGHDVNYTGMNRELNNGM
QVHMAGGSSALLSLQLEDWLEMDKPVNIPGTFDEYPNWRRKLTENIESMFDRHDINELAS
KLTHARKQASQG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaacttctgcaacaactggttgaaatgcggggaatagaaacccaatacgtc
gacgcatggggaaagccagcaaccatcgcagaatcaagtaaagcaaaactgcttaacaca
cttggctatgacaccagtagtgacgaaaaaattcagtcacaaattacacaagatattaag
tcggtatggttgtcgccattaaatcctgttcaagtggtgcgtaacactcaagaaattaac
gtagcggttcgtttgcctattgaattggtgaacgatgaccacgtgcttaccatcacttgt
gaaaatggtgatgttcttactcatcaatttacgccagttgaccaagaaatgacaactatg
gcgcatatcgatgatgtggagttccatgaatatgttgtgacgctgcctttggatttgccc
cttgggtatcacgacgttgccttaagtgcagataacgatgagtttgcgcgttctcgttta
attgtggcacctgaagcctgctacacgccaaacgagattaaagaagggaaaaagatttgg
ggtttaagcgttcaactttactgtgtacgcagtgaaaagaactggggaattggtgacttt
tctgatttagctctgcttattgaaaaagccgctggtgttggcgcagactttatcgggctt
aatcctattcacgcgctttaccctgcaaaccctaatgcgtgctcgccttatggaccaagc
tcgcgtcgttggcttaattatttgtatatcaatgtgactgccattgacggttacgacgac
gcatcagtacaagccgtagttaatagtgatgaatttaaagctacacttgaccatgcgcgt
aatgtcgaacatgtagactatgaagcggtagctcatttgaagttggctgcgcttaaagca
gtatttgatgtttacgatgccaaataccttcgtaaaagcacaaagcagaataaagcgttt
aaagccttcgtagaagcgggcggtgaaagcttagatatgttagcggtgtacgatgcattg
caatcgcacttgaaagctgaaggcaaagacagctggggctggccggtatttccacaagaa
tacaaagattatcacaaccctgctgtagctaagtttaagagcgctaacgagcaagatgtc
aaattctaccttttccttcagtggattgctgcacagcagcttgaacttgcaagtagtaaa
gctacagatgcgggtatgactattgggctttatcgcgacttggcggtaggggtgagcgaa
ggcagtgcggaaatttggggtaacaaagacctatattgcacaggcgcaagcgtaggtgct
ccaccggatatcttaggcccactaggccagaactgggggttgccgcctatggaccctcgt
aagctgtatgaacagggttatcaacctattattgacttgtttgcgtctaacatggcgtcg
tctggttcactgcgcatcgatcacgttatggcgttgctgcgtttatggtgggtagtgaaa
ggtgataatgctaaagatggtggttacgtttattacccagtagatgatttgcttggtatt
ttagcgctagaaagtcaccgtaatcaaagcctggttattggtgaagacttgggtactgta
ccagaagaaattcgcagtaagcttgccgataatggcgtgtactcataccgcgtatttttc
ttcgaacaagccgaagacggtggtttcttctcacctagccattatcctgttcagtctatg
tcaacattgactactcacgatatgccgacgctaattggttactggcactgtctagattta
gagttaggcaaagagatagggctatatccaacagaagaaattctacaaacgctttatgcg
gatcgtcacgaaaacaaacaggcgattttagatactttgcacggccacggctcaattggc
gacaacgtgggtcacgatgtgaactacacaggcatgaaccgcgaactgaataacggtatg
caggtacacatggctggtggttcaagtgctctgttaagccttcagttagaagattggtta
gaaatggataagccggtaaatattccgggcacatttgacgagtatccgaactggcgaaga
aaactcaccgagaatatcgagtcgatgttcgatagacatgatataaatgagttagcgtct
aaacttactcatgccagaaagcaagcaagtcagggttaa

DBGET integrated database retrieval system