KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_11010Help
Entry
AMBLS11_11010     CDS       T02260                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBLS11_11010
Enzymes [BR:amk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AMBLS11_11010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2590708..2591559
Genome map
AA seq 283 aa AA seqDB search
MPPVSSVTVSESNGLTFLDVDNAFASARISLFGGHILSYVPKSDGRERLWVSPHAYLNGE
RPIRGGIPVCWPWFSDDHGREKGALPAHGFLRTQVWKLVNSEDTDTGTTITLSPSFTRAE
GFENDCNVTMVISVGKTMDVSLITENIGVAPFEFNCALHTYFHVDHIQHTQINGIEGQYK
DKLDDWGLKTTPSPYTITGETDRIHIAPIKTAEIEVEGSVFTEVISDGNDSLVVWNPWLG
AASISDMDPFGYKHMLCVETSLTQGKTLSPGASHTLKQTIAPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgttagttcagtaaccgttagcgagtctaatggacttacctttttagacgta
gataacgcatttgcctctgcgcgtattagcttatttggcggtcatatcttgtcatatgtg
cctaaaagcgatggtagagagcgtctttgggtaagcccccatgcttacttaaatggagag
cgaccaattcgcggtggtattccggtatgctggccttggtttagcgacgatcacggtcga
gaaaaaggcgccctacccgcacatggttttttaagaacacaggtatggaagctggtcaat
tcagaagatacagacaccggaacaacaattaccctttcgccaagctttactcgagcggaa
ggctttgagaatgattgtaatgtgaccatggtaatctctgttggtaaaacaatggacgtg
tctttaatcactgaaaatatcggcgttgccccctttgaatttaattgtgcgcttcatacg
tactttcatgttgatcacattcaacatacacaaataaatggcatagaaggtcagtataaa
gacaaacttgacgactggggattaaagacaacaccaagtccatacacgattacaggtgaa
acagaccgcattcacattgcgccgattaaaactgctgagattgaagttgaaggcagcgtg
tttacagaagtaatatctgacggtaatgactctttggttgtatggaacccatggttaggc
gcagcgtctatttcagacatggacccgtttggctataagcacatgttgtgcgtagaaaca
tcgctaactcagggaaagacactgtcccccggtgctagccacacgcttaaacaaactatc
gctccgcgataa

DBGET integrated database retrieval system