KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_11195Help
Entry
AMBLS11_11195     CDS       T02260                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMBLS11_11195
   00500 Starch and sucrose metabolism
    AMBLS11_11195
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AMBLS11_11195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2635835..2637037
Genome map
AA seq 400 aa AA seqDB search
MNIIKARNDVYKAFALMAGILFTGCCLAMPAGTDIVVMKSRTNEAVDTSVNASPHQFQTV
NQAVAYVESQAQQQGKIWTIFVKEGTYRERVVIAVDNLRIVGESRDATTIVFNRYAGQKV
SDGSEEKWGTRRTATVEILGNNVTIENITITNDFDYPGNEVKAKDDPTRLSGTQAVALKT
DVNSDRTYLNNVALWGYQDTLYLKGDRALIEGGIIAGHIDFIFGEGTAFFDGVTILSRAR
YSNGDAEGLTGYITAPSTHLQRPYGLTFHNCKLEREDGVPDMSVALGRPWHPTTSFSDGR
YANPYAVGKTTFINTYMSGHITQARWTTMGGTTPSGEKRPFSPHTEARFSEYQSHGEGAY
DRATTPAMESHFLDANAAAFYTKEAVLRGWRPDTTIYNIK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacattatcaaagcgcgtaacgatgtttataaagcctttgcgctaatggcaggtatt
ctattcactggttgttgtctagcaatgcctgctggtaccgatattgtagttatgaaatca
cgtaccaatgaagctgttgatacgtcagtgaatgcatccccccatcagtttcaaacggtt
aaccaggcagtggcgtatgttgaatctcaagcgcaacagcagggcaaaatttggactatt
ttcgtaaaagaaggcacctaccgagaacgggttgtgatcgccgtagataatcttcgtatc
gttggtgaatcgcgagatgcaacaactatcgtgtttaaccgatacgcagggcaaaaggtc
tcagacggttctgaagaaaaatggggaacccgtcgcaccgccacggtggaaatattagga
aataatgtcaccatagagaacatcactatcaccaacgattttgattatcccggtaacgag
gttaaagcaaaagatgacccgactcgcctctcaggtacacaagcggtagcacttaaaaca
gacgttaattcagatcgcacttatcttaacaacgtcgcgctatggggttaccaagacacc
ctttatttgaaaggtgaccgcgctctgatagaaggcggaataatagcaggacatatagat
tttatttttggggaaggcacagcattttttgatggcgtcacaattctttcaagagcccgt
tattccaacggcgatgccgaaggacttactggttacattactgcaccaagtacgcactta
cagcggccatatggactcacgttccataactgcaagctagaaagagaagatggtgtgcca
gatatgagcgttgcactaggaagaccttggcatccaacgaccagcttttctgatggccgc
tatgccaatccttatgcggtaggcaaaaccacatttataaacacctacatgtcaggacat
attacgcaagctcgttggactaccatgggtggcactaccccatcgggagaaaaaaggcca
tttagtcctcacaccgaagccaggttttctgaataccaatctcatggtgaaggtgcctac
gacagagctactacaccagcaatggagtctcattttctagatgccaacgctgcagctttt
tacaccaaagaggcggtattgcgaggctggaggccggataccacaatctacaatattaaa
tag

DBGET integrated database retrieval system