KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_11840Help
Entry
AMBLS11_11840     CDS       T02260                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amk01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:amk00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2782649..2783953
Genome map
AA seq 434 aa AA seqDB search
MITWSSLSANEKKQALARPAMANSQQLKKTVGDIIARVEAEGDAAVLDYTRKFDCPDLTN
LVLSQDDIDALAAKVTPVVASAIDTAFNNIKAFHEAQMPSDIALTTTPGVKCELRFTALD
AVGLYIPGGSAPLPSTVLMLGVPALVAGCENKLLCTPPNKEQLIAPEIAYAARKCGIDKI
FLCGGAQAVAAMALGTNTIPQVDKIFGPGNSFVTEAKQQVSQRADGAAIDMPAGPSEVLV
LADEFANPEFVAADLLSQAEHGPDSQAILVSNSATLIEEAKAAVERQLATLSRAEIARPA
MENARYILADSIEQAIEASNAYAAEHLIVQIENARDYLPKIKYAGSIFLGPWSPESAGDY
ASGTNHVLPTYGYAKNYSSLGLLDFMRRYTIQELSEDGMRNLGPAIMALAAAEGLDAHEQ
AVALRMQALKQGDA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgattacttggtcatctctttcggcaaatgagaaaaaacaggcgctagcccgcccggct
atggccaatagccaacagttaaagaaaaccgtgggcgacattatcgcccgcgttgaagca
gaaggcgatgcggcagttctggattacacacgtaaatttgactgtcctgacctaaccaat
cttgtgctttcacaagacgacattgatgcccttgctgccaaggtaacgccagtagtggca
agtgctatcgacactgcgtttaataacattaaagcctttcacgaagcacaaatgcccagt
gatatcgcgctcactaccacaccaggtgttaaatgtgagcttcgctttactgcacttgat
gcagtaggtctttatattccgggtggcagcgcgccacttccttctaccgtgttaatgctg
ggcgtgcctgcattggtggcgggctgtgaaaataaactgctttgcacaccaccaaataaa
gaacagcttatcgcgcctgaaattgcctatgcggccagaaagtgcggtatcgacaaaatc
tttttatgtggtggcgctcaagcggttgcagccatggcgttgggtacaaacaccattcca
caggttgataaaattttcggcccaggaaacagctttgtgactgaagctaaacagcaagta
agccagcgtgctgatggcgcagctattgatatgccggcgggaccgtcagaagtgttagta
cttgcggatgagttcgcaaaccctgaatttgtggctgctgatttactttcccaagccgag
cacggtccagactcgcaggctattttagtgtctaacagcgctacgctcattgaagaagct
aaagccgccgttgaacgtcaattagcgaccttatctcgcgctgaaattgcacgccctgct
atggaaaatgcgcgttatattttggctgattcaattgagcaagccattgaagcaagtaac
gcctacgccgctgagcacttaattgtacaaatagagaatgcccgtgattacttgccaaaa
attaaatacgcaggctctatattcctaggcccgtggtcaccagagtctgccggtgattac
gcgtcaggtactaaccacgtactgccaacttatggctatgctaagaattattccagcctt
ggtcttttagactttatgcgccgctacacaattcaagagttgagtgaagacggcatgcgc
aatttaggccctgcgattatggcactagcggcagcagaaggtttagatgcacacgaacaa
gccgttgcacttcgtatgcaggcacttaagcaaggagacgcctaa

DBGET integrated database retrieval system