KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_12780Help
Entry
AMBLS11_12780     CDS       T02260                                 

Definition
Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMBLS11_12780
   00565 Ether lipid metabolism
    AMBLS11_12780
   00590 Arachidonic acid metabolism
    AMBLS11_12780
   00591 Linoleic acid metabolism
    AMBLS11_12780
   00592 alpha-Linolenic acid metabolism
    AMBLS11_12780
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     AMBLS11_12780
    3.1.1.32  phospholipase A1
     AMBLS11_12780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2989399..2990418
Genome map
AA seq 339 aa AA seqDB search
MSVLKPFVFLAALFAACTPVCAQQSSEVVNEQSQTVESSEQATATKSEENQTSQNEEGIE
VIDIIKRDTITESALDNRLEGDKEALDNVFAITQHRQNYLLPITYVSNPSTVASEELTNE
NVDNKEAKFQVSAKLPLYLEDTGFDGIYFGFTLTSFWQLYNNEASKPFRETNYEPEVFWQ
ETADYSVLGYKFNTFQVGFNHMSNGQSGLRSRSWNRIFASIVFSDDDDIYYLKTWYRIPE
DEKTDPLDPTGDDNPDILDYYGRMEFGYGRKIGAFKVLALLRNNLDLDENRGSIQLDFTY
PISDRYEVLLQYFNGYGDSLIDYNRSQERIGIGFQLLFL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtgttaaagccttttgtatttttggcagcactatttgctgcctgcacgcctgtg
tgcgcacaacagtcgtcagaagtggtaaacgaacaatcacaaactgttgaaagtagcgaa
caagcaaccgcgactaaaagtgaagaaaatcaaacgtcacaaaatgaagaaggtattgaa
gttattgatatcatcaaacgtgacactatcaccgaaagtgcgcttgataatcgcttagaa
ggtgataaagaagcgttagataacgttttcgctatcactcagcatagacaaaattatcta
cttccaattacctacgtttccaaccctagcactgtcgccagtgaggagttgacgaacgaa
aacgttgataataaagaagcaaaattccaagtgagtgcaaagcttcctctgtatttggaa
gatacaggattcgatggtatttattttggttttaccctgacttctttttggcaactctac
aataacgaagcatctaaaccttttcgcgaaaccaactatgaaccagaagtcttttggcaa
gagactgcggattactctgtacttggctacaagtttaatacttttcaggtgggtttcaat
catatgtcaaatggtcaaagtgggctacgctctcgaagctggaaccgcatatttgcatcg
attgtttttagcgacgacgacgatatctactacctaaaaacctggtaccgtattcctgaa
gacgagaaaacagacccgcttgatcctaccggtgacgataacccagatatactagactat
tacggtagaatggaatttggttatggcagaaaaattggagcttttaaggtgctggcgctt
ttgcgaaacaaccttgatttagatgagaaccggggcagtattcagttggacttcacctac
cctatctctgaccgttatgaagtattactgcagtattttaacggctatggcgactcgctt
atcgattataaccgttcacaggaacgcattggtattggcttccagctattgtttttataa

DBGET integrated database retrieval system