KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13055Help
Entry
AMBLS11_13055     CDS       T02260                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_13055
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMBLS11_13055
Enzymes [BR:amk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AMBLS11_13055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3046533..3048128
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGVEDLNE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWSEEGKDVSGYDRAKLMSADYDD
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acttgggaaggtatcaacccagaattcgctgcacgcatgaaggttcagaaccgttttaaa
actggtttagatattgctcgttatacagcaagtatcatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcgctaggttgctggcatggcttcgtaggccag
caaaaaatgctttcagttaaaaagcatcaaggcacaacgaataaaagctacctttacctt
tcaggctggatggtagcggcacttcgctctgaattcggtcctcttccagaccaatcaatg
catgagaaaacgtcagtttctgcacttatcgaagagctttacactttccttcgtcaagca
gatgcgcgtgaattgggcgaccttttccacaagctagacgacgctaagaaaaatggcggt
gatgttgctgctattcaagctgaaatcgataactacgagactcacgtagttccaattatc
gcagacatcgacgctggcttcggtaacgaagaagcaacgtacctacttgcaaagcaaatg
attgaagccggtgcatgctgtatccaaattgaaaaccaagtatcagacgctaagcaatgt
ggtcaccaagacggtaaagtaactgtgcctcacgaagacttcctagcgaagatcaatgca
gtacgctatgcattccttgaactaggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtctgactcagaagatcccagtatctacatcagaaggtgacctggct
gcccagtacaacgcgttccttaaaacgactgaagttgcaggtgttgaagacctaaatgaa
ggtgacttagtgcttaagcaaggtggcaagctggttaaacctgagcgcttaccaaacggt
ctgttccgctttaaagacaatacaggttttgaccgtgtagtacttgactgtgtaacgtcg
cttaaacacggtgctgacttgctatggattgagactgaaaagcctcacgtaggtcaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaatgctaagctggtgtataacaat
tctccatcatttaactggacacttaacttccgtcagcaagtatttgatgcttggagcgaa
gaaggtaaagatgtttctggatatgaccgcgcgaaacttatgtctgctgactatgatgac
agcgaacttgcagcagcggcagacgagaagattaagagcttccaggctgatgcagcgcgt
gaagcaggtatcttccaccaccttatcactctaccgacttatcatactgcagcactgtct
actgacaaccttgctaaaggttacttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagagattcgccagggcctagcgtgtgttaagcaccaagcgatggcaggt
tctgacctaggtgatacgcacaaagagtacttctctggtgaaggtgcacttaaagcatct
ggtgaagacaacaccatgaaccagtttgatgtgtaa

DBGET integrated database retrieval system