KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13055Help
Entry
AMBLS11_13055     CDS       T02260                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_13055
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMBLS11_13055
Enzymes [BR:amk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AMBLS11_13055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3046533..3048128
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGVEDLNE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWSEEGKDVSGYDRAKLMSADYDD
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acttgggaaggtatcaacccagaattcgctgcacgcatgaaggttcagaaccgttttaaa
actggtttagatattgctcgttatacagcaagtatcatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcgctaggttgctggcatggcttcgtaggccag
caaaaaatgctttcagttaaaaagcatcaaggcacaacgaataaaagctacctttacctt
tcaggctggatggtagcggcacttcgctctgaattcggtcctcttccagaccaatcaatg
catgagaaaacgtcagtttctgcacttatcgaagagctttacactttccttcgtcaagca
gatgcgcgtgaattgggcgaccttttccacaagctagacgacgctaagaaaaatggcggt
gatgttgctgctattcaagctgaaatcgataactacgagactcacgtagttccaattatc
gcagacatcgacgctggcttcggtaacgaagaagcaacgtacctacttgcaaagcaaatg
attgaagccggtgcatgctgtatccaaattgaaaaccaagtatcagacgctaagcaatgt
ggtcaccaagacggtaaagtaactgtgcctcacgaagacttcctagcgaagatcaatgca
gtacgctatgcattccttgaactaggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtctgactcagaagatcccagtatctacatcagaaggtgacctggct
gcccagtacaacgcgttccttaaaacgactgaagttgcaggtgttgaagacctaaatgaa
ggtgacttagtgcttaagcaaggtggcaagctggttaaacctgagcgcttaccaaacggt
ctgttccgctttaaagacaatacaggttttgaccgtgtagtacttgactgtgtaacgtcg
cttaaacacggtgctgacttgctatggattgagactgaaaagcctcacgtaggtcaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaatgctaagctggtgtataacaat
tctccatcatttaactggacacttaacttccgtcagcaagtatttgatgcttggagcgaa
gaaggtaaagatgtttctggatatgaccgcgcgaaacttatgtctgctgactatgatgac
agcgaacttgcagcagcggcagacgagaagattaagagcttccaggctgatgcagcgcgt
gaagcaggtatcttccaccaccttatcactctaccgacttatcatactgcagcactgtct
actgacaaccttgctaaaggttacttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagagattcgccagggcctagcgtgtgttaagcaccaagcgatggcaggt
tctgacctaggtgatacgcacaaagagtacttctctggtgaaggtgcacttaaagcatct
ggtgaagacaacaccatgaaccagtttgatgtgtaa

DBGET integrated database retrieval system