KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13065Help
Entry
AMBLS11_13065     CDS       T02260                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_13065
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMBLS11_13065
   00630 Glyoxylate and dicarboxylate metabolism
    AMBLS11_13065
Enzymes [BR:amk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMBLS11_13065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3049454..3051649
Genome map
AA seq 731 aa AA seqDB search
MQGYITRGRLQVAEQLDNFINEQALPGTGVDKDTFWQGAETLFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVKGNEYTDFLRSIGYLVEQPSQVSAQTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNEGGAEAGKSYNPVRGAKVVAKAKSYLDSMIPL
AKGSHADVTEYKIESGKLAITLADGDETTLANTVQWQGYQGDISAPSSLLFAHNGLHFEI
QLDPTHPIGESDAANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGTLSI
EMTKGGKQLVRAMHEDRSYQPSKHASQDELKDGKLVLSGRSLMFVRNVGHLMTNNAMLFD
GEEVPEGIMDGLVTSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
AIIDVPANTLKMGIMDEERRTSINLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAGPF
AEKAALKSMAWIKAYETANVAVGLRCGLSGRAQIGKGMWPIPDEMQNMMSTKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDQNFDGLADILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMATLVDEQNAGDPEYIPMAPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAAS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattactagaggccgactacaggttgccgaacagctcgataactttatt
aatgaacaggcacttcctggtacaggcgtagataaagacaccttttggcaaggtgccgaa
accctctttgaaaaattcattcctcaaaatcgcgcattattagaaaagcgggagcagctt
cagcgcgctatcgacgattatcacaaagccggcaacccggtaaagggaaacgaatatact
gactttcttagaagcattggttaccttgtagagcagccatcacaagtaagcgcacaaaca
caaaatgtagacgcagagattgcgactatggcaggccctcagttagtggtgccaattaat
aacgctcgctacgcgctcaacgctgtaaacgcacgatggggaagcctttatgatgcacta
tacggcactgacgttatcagtaatgaaggtggcgcagaggcaggaaaaagctataaccct
gtacgcggcgctaaagttgtagctaaagcgaaaagctacttagatagcatgataccgcta
gcaaaaggcagccacgctgacgttactgaatataagattgaatctggtaaattggcgatt
actcttgctgacggcgatgagactactttagcaaatacggtgcaatggcaaggatatcaa
ggcgatattagcgccccctctagtctgcttttcgcccacaacggtctacactttgaaatt
caactagacccgacccacccgattggcgaaagcgatgccgcaaacgtaaaagacgtattg
gttgaagcagcactgactaccattatggattgcgaagattccgttgccgctgttgacgct
gaagacaaaaccttggtgtatagcaattggcttggcttgatgaaaggcacgctaagcatt
gaaatgacaaaaggtggtaaacagttagttcgtgctatgcatgaagatagaagctatcag
ccgtctaaacacgcttcacaagacgaattaaaagacggcaaactagtactttctggtcgc
agccttatgtttgttaggaatgtgggtcaccttatgaccaacaatgccatgctcttcgac
ggtgaagaagtacctgaaggcatcatggacggtttagtcacttctcttattgcaaagcat
gatctattaggaaacagcaaatttaaaaacagccgcgaaggtagtatttatattgttaaa
cctaaaatgcacgggccagaagaagttgcattctctaacgcgttgtttggtgctatcgaa
gcgattatcgatgttccagccaacacccttaaaatgggcataatggatgaagagcgccgt
acgagtatcaatctacaagcttgtattgccgaggctacttcacgcgtcgtgttcattaac
acgggtttcttagacagaactggtgacgaaattcatacctcaatgcttgcggggcctttc
gcagaaaaagccgcgcttaaatcaatggcgtggatcaaggcttatgaaactgccaacgtt
gccgtaggccttcgttgtggcctttcaggcagagcacaaatcggtaaaggcatgtggcct
atacctgatgaaatgcaaaatatgatgagtactaaaatcggccacccgaaggccggcgcg
aatactgcctgggtaccctctcctactgctgcgacactacatgcgcttcattatcacgat
gtaaatgtatttgacgttcaaaagtcgttagatcaaaacttcgatggtcttgccgatatt
ttgaccattccacttttggaggacgcttctacgctaacacgtgaaagcataaaacgtgag
attgataacaacgttcaaggtatcttgggctacgttgtacgctgggttcaccaaggcgta
ggctgctcgaaagttcctgacatcaacaatgtaggcttgatggaagaccgcgcgacgtta
cgaatatcctctcagcacatcgctaactggcttgagcacggtattgtgagtgttgatcaa
gtaaaagagtctttggctcgtatggcgactctggtagatgagcaaaatgccggcgaccct
gaatatatcccgatggcacctgatttagacagctcaattggctttttggccgcgagcgac
cttatctttaaaggtaaagagcagcctagcggttacactgaacctttactacacgctcga
agacgtgagatgaaggcaaagcttgcggcgagctaa

DBGET integrated database retrieval system