KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13775Help
Entry
AMBLS11_13775     CDS       T02260                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMBLS11_13775
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMBLS11_13775
Enzymes [BR:amk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMBLS11_13775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3228914..3231466)
Genome map
AA seq 850 aa AA seqDB search
MIRNTTNIVKACLSLSLLLVSSASAMAETPSLQQTSLNALGESLDIHYEVLSNVDDSLCR
VHIPKGDCFSSELTIATMATPIEASTSLYFSHIAPIRGYDSKNAIRIEHINGDLHRLTFE
EKVNASDQVKVTLSAPFWHASRSDAMPNYYLTYPALLPVIVASTTRVKEPGSNLLINQHT
GLWSKQAQYKRTENDNTPLMDSAYLYNKGDSALISDDAQNRVIPNVGQRDDSGKFVSAAG
IYIDKSDQDMLAPAIEQMAYFGLTNQKTGLPLKVIIGSANNANALANEAATINSKEGYAL
SITEQSATIIANDNIGANYGLLTLMQVFDVQKGRFPITEIADSPRFEFRGMHLDIARHFA
GKAAIESVVRQMFTYKLNKLHLHLSDDEGWRLAIDALPELTEIGAFRCHDLSETQCLLPQ
LGSGPFKSATGNGFLTQQDYIDILTMAHARGIEVIPSLDMPGHARAAIVAMNARYKRLMA
EGNSEAANEFLLVDKEDKTQYQSVQFYSDNTINPCLDSSYHFIETVLTSVKSLHEKASVP
LTHFHVGADETAGAWVKSPVCAAKGQKADEILPAFVTEVQKIAQKHNIAIGGWSDGMEKA
VNTLDNSSAYTNVWHLLAAGGEKTVSHFAKENIPVVLSFPDVLYFDFPYQSNPYEPGYYW
GSRATNTEKVFSFMPEQLPLHAELWTDRMGHSYSSSAEADTSSVIGIQGQLWSEVTVNQD
AVEYMVFPRLLALAERAWHYAPWQQNAKALHEKGGLVNRQSNDWQAFELALFNRHAPALV
QQGVNVRVPTPAAVINNGKLHIKPVSGLTMEYLTSDNKWETFTAPVEVKGSVTVRARIAG
TQQMSRQVQL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcaatacgacgaatattgtcaaagcgtgcttgagcttatcgttactgctagtg
agtagcgcttcggcaatggctgaaacgccttcgctacagcaaaccagcttgaatgcgcta
ggagaaagcctcgatatacattacgaagtattaagtaatgtggacgatagtttgtgccgg
gtacatattccaaaaggcgactgcttttcgtcagagcttaccatagcaaccatggcaacc
cccattgaagcctctacgtcgctttactttagtcatattgcgcctattcgcgggtatgac
tcaaaaaatgcaattcgcattgagcatataaacggtgacctgcaccgcctaacgttcgaa
gaaaaggtgaacgcaagtgatcaagttaaggtaacgctatctgcgcctttttggcacgcc
tctcgctcggacgcaatgccgaactattatttaacttaccctgctttattaccggtgatt
gttgcctccacaacccgtgtgaaagagccgggaagcaatttactcatcaatcaacacact
ggcttatggagcaaacaagcccagtacaaacgtactgaaaacgacaatacaccgcttatg
gacagcgcgtatttatacaataagggcgattcagcgctaatttcagatgatgcccagaac
cgtgttattcctaacgtaggtcaaagagatgattcgggtaaatttgtttctgccgcgggc
atttatatagataagtctgatcaagacatgcttgctccagccattgagcaaatggcctat
tttggcctcactaaccagaaaacaggcttaccacttaaggttattattggcagcgctaac
aatgcgaacgcccttgcaaatgaagctgcaacaataaactcaaaagaaggctatgcgctt
agcataacagagcaaagcgctacgataattgccaacgataacattggtgctaactacggt
ctgttaacgctaatgcaagtatttgatgtgcagaaaggccgctttcctatcactgaaatt
gcagactcgccacgattcgaatttcgcggaatgcacttagatattgctcgacactttgcg
ggaaaagccgcgattgaatctgttgttcgccaaatgttcacctataagctcaataagcta
cacctacacctaagtgatgacgagggctggagattagctatcgatgctttgccagagctt
accgaaattggtgcgtttcgatgccacgatttgtctgaaacacagtgcttgctacctcag
ctaggaagcggaccttttaaaagtgctacaggcaatggctttcttacgcagcaagactac
attgatattttaacaatggcgcatgcgcgcgggattgaagttattccgtcgcttgatatg
cctggccatgcccgcgcagcaattgttgctatgaatgcgcgctacaagcggcttatggca
gagggtaactcagaggctgcaaatgaatttttattggtagataaagaagataaaacccaa
tatcaaagcgttcaattctattcagataacaccataaacccctgtttagatagcagctat
cattttatcgaaaccgtacttacttctgtgaaatcactgcatgaaaaggccagcgttccg
ttgacgcacttccatgttggcgccgatgaaaccgccggtgcttgggtgaaatcccctgta
tgcgctgcgaaaggtcaaaaggcagatgaaatactgccggcttttgttaccgaagtgcag
aaaattgcgcaaaagcacaatatagcaattggtggctggagcgatggcatggaaaaagcc
gtaaatacactggataacagcagcgcgtataccaacgtttggcatcttcttgctgcggga
ggagagaaaacagtatcgcattttgccaaggaaaatattccagtagtactctcgtttcca
gacgtgctttattttgactttccttaccaaagtaatccttatgagcccggttattactgg
ggttcacgggcaaccaataccgaaaaagtattttcgtttatgccagaacagctgccgctt
catgccgagttatggaccgaccgtatgggccacagttacagcagttctgctgaggccgac
acatcatcagtaatcggtattcaggggcagctgtggtcagaagtcaccgtgaatcaagat
gccgtggaatatatggtgtttccccgactattggccttggctgaacgcgcctggcactac
gcaccatggcaacaaaacgcgaaagcacttcatgaaaaaggcggtttagtaaaccggcag
tcaaacgactggcaagcgtttgagttagcgttatttaaccgtcatgcacccgcgctagtg
cagcagggagtgaatgtgcgtgtacctacgccagcagcggtaattaacaatggtaagtta
catataaagccagtgtctggtcttacgatggagtacttaacttcagataataagtgggaa
acctttactgctcctgttgaagtgaaggggagcgtcactgttcgcgctagaattgcggga
acacagcaaatgagtcgacaggtgcagctgtaa

DBGET integrated database retrieval system