KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13850Help
Entry
AMBLS11_13850     CDS       T02260                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMBLS11_13850
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AMBLS11_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3252030..3252926
Genome map
AA seq 298 aa AA seqDB search
MAIINFGSINIDHVYQVEHFVQPGETLASTHYQTLLGGKGANQSIALAQAGADVRHVGSI
HENDASFKQDLIKKGVDCRGVKCSEVPSGHAIIQVTPSGENAIVLFGGANQTITAKTVMQ
ALDDTRPSDWVLTQNETSSIEEVLRQAKEKQLKVAFNPAPMSESVKQLPLDCVDLLIVNE
TEAAAITGKEELEDIVTVFKEQWSHCEVIITLGKAGVMMLRKNDVVEVKAFSVDAVDTTA
AGDTFIGYFLSAYSNHTDAKQALRRGCAASAIAVTREGAAQSIPTQKEVDRFLAKHAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaataataaattttggctctataaatattgaccacgtttatcaggtagaacacttt
gtgcaacctggtgagacgttggcctctacccattaccaaaccttattaggcggtaagggt
gcaaaccagtctattgctttagcgcaagcaggtgcagacgtacgacacgtcggtagcatt
cacgaaaacgacgcatcattcaaacaagaccttattaaaaaaggtgttgattgccgcggt
gtgaagtgttcagaagtcccttcagggcacgcgattattcaagttacgccaagcggtgag
aacgccattgtattatttggtggtgctaaccaaaccattactgcgaaaacagtaatgcag
gcgctggacgatacgcgtccttcagactgggtattaactcagaatgaaaccagcagcatt
gaagaagtacttcgccaagcgaaagaaaagcagcttaaagtagcctttaacccagcgcct
atgagcgagtcggttaagcagcttccattggattgtgtcgatttacttattgtaaacgaa
acagaagctgccgcgattaccggtaaagaagaacttgaagatattgtgacagtgttcaaa
gagcagtggtcacactgcgaagttattattacactgggtaaggctggtgtaatgatgctg
cgcaaaaacgatgttgtggaagtaaaagcattctctgtagatgcggtagataccactgca
gccggtgacacctttatcggttatttcctgtctgcatacagcaaccacaccgatgctaag
caagcattgcgtcgcgggtgtgcagcttcggccattgcggtaacacgcgagggcgcagca
cagagtattccaacacaaaaagaagtggatcgtttcttagcgaaacacgccaactag

DBGET integrated database retrieval system