KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_13925Help
Entry
AMBLS11_13925     CDS       T02260                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00010  Glycolysis / Gluconeogenesis
amk00020  Citrate cycle (TCA cycle)
amk00620  Pyruvate metabolism
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01130  Biosynthesis of antibiotics
amk01200  Carbon metabolism
Module
amk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBLS11_13925
   00020 Citrate cycle (TCA cycle)
    AMBLS11_13925
   00620 Pyruvate metabolism
    AMBLS11_13925
Enzymes [BR:amk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMBLS11_13925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RTBV_P12
Motif
Other DBs
NCBI-ProteinID: AFT79354
UniProt: K0D0J2
Position
complement(3270598..3272613)
Genome map
AA seq 671 aa AA seqDB search
MSDIQKIIVPDVGGDEVEVIELCVAVGDNIEADEGVVTVESDKASMDIPAPFEGEIVSLS
VSVGDKIKEGDVIGEMKVAGGDSGSAAESSSSDESSKEDAPKQEEAPKEESKSDAAPAAS
GSSEVIEVAVPDIGSDDEVDVIDVLVSVGDTIEKEDGLITLETDKATMDVPSTHAGTVKE
VFISTGDKVKEGTVVIKLEVAGSGSSSSESASSKSSEASAPAAQQSEKQESAPAASASSE
TIEVAVPDIGEDGEVDVIDVLVSVGDTVEKEDGLITLETDKATMDVSSTHAGTIKEVFIK
TGDKVKQGTLVVKLETSGGSSSSAAEKPAEAPKQEETKQESQQEASQGRSPVPPAPEAKN
TGKAHASPSVRRIAREFGVDLTQVNGSGPKNRILKEDVQAYVKAELAKPRTAAASGSAPV
GDNVLQIVPVKPVDHSKFGEIEEQPLSRIQKISGPFLHRNWATIPHVTQFDEADITEVEE
FRKEQNAYHAKIKSGLKITPLVFVMKAVAKALEKYEVFNSSLSDDGESLIIKKFINIGIA
VETPGGLVVPVIRDVNKKGIEQLSQELIETSKKAREGKLKAADMQGGTFTISSLGGIGGT
AFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPRLMVPLSLSYDHRVIDGAVGARFSTEVA
ANLTDLRRIIL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaaagattatcgtacccgatgtaggcggtgacgaagttgaagttatc
gagctatgtgttgccgtaggcgacaacattgaggcagatgaaggcgttgttactgttgaa
agtgacaaagcgtcaatggacatccctgcaccgtttgaaggtgagattgtaagcctgtct
gtatcagtaggcgataaaatcaaagaaggtgatgtgattggtgaaatgaaagttgctggt
ggagatagtggcagcgccgctgaatcatcatcttcagatgaatcttctaaagaagatgca
cctaagcaagaagaagcaccaaaagaagaaagcaagtcagacgcagcacctgctgcatct
ggcagcagcgaagtcattgaagttgcagttccagatattggctctgacgacgaagtagac
gtaatcgacgtattggtttcagtgggcgacaccattgaaaaagaagatgggctaattacc
cttgaaaccgataaagcgaccatggatgttccttcaacacacgcaggtactgtgaaagaa
gtattcattagtactggtgataaagtgaaagaaggcacggtagtgatcaaacttgaagtt
gccggctctggctcatcttcaagtgaatcggcctcaagtaagtcttctgaagcatctgct
ccggctgctcaacaaagtgaaaagcaagaatcagcgccagccgcgtctgcaagcagcgaa
actattgaagttgcggtacctgacatcggtgaagacggtgaagttgacgttatcgacgtg
cttgtgtcggtaggcgacaccgttgaaaaagaagacggtctaattacgctagaaactgat
aaagccaccatggatgtgtcttcaacgcatgcaggtacgattaaagaagtctttatcaaa
acgggcgacaaagttaagcaaggcaccttggttgttaagctagagaccagcggtggctcg
tcttcaagtgcagctgaaaagcctgctgaagcgcctaagcaagaagagactaaacaagag
tcacagcaggaagcttcacaaggccgttctcctgtgcctccagcaccagaagccaagaat
acaggtaaagcacatgcttctccttcggtacgccgtatcgctcgtgaatttggtgtagac
ctgactcaagttaacggctctggccctaaaaaccgtatcttgaaagaagacgttcaagcc
tatgtgaaagctgagcttgcgaaacctcgcacagcagcagcttctggcagtgcgcctgtg
ggcgacaacgtacttcaaatcgtgccggttaagcctgttgatcacagcaagtttggcgag
attgaagagcagccattatctcgtattcagaagatttctggtccgttcttacaccgtaat
tgggcgactatcccgcacgttacgcagttcgacgaagcagatatcacagaagttgaagaa
ttccgtaaagagcaaaacgcttaccacgcgaaaattaagtctggtcttaagatcacgcct
ttggtattcgtaatgaaagcggtagcgaaagcccttgaaaaatacgaagtattcaactca
tcactgtctgatgatggcgagagcttaatcattaagaaatttatcaacattggtattgcg
gttgaaacaccgggaggccttgttgtacctgttattcgtgacgtgaataagaaaggtatt
gagcagctgtctcaagaacttatcgaaacatctaagaaagcccgtgaaggcaagcttaaa
gcggccgacatgcagggtggtacgttcaccatctctagcctaggtggtattggtggcacg
gcgtttacgcctattgtaaatgctccagaagtcgccatattaggtgtgtctaagtctgag
atgaagcctaagtggaatggtaaagagtttgagccgcgcttaatggtgccgctaagcctg
tcttacgaccaccgagtgatcgatggtgcggtaggtgcaagattctctactgaggttgct
gcaaacctaactgacttgcgcagaatcatactttaa

DBGET integrated database retrieval system