KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_14065Help
Entry
AMBLS11_14065     CDS       T02260                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AMBLS11_14065
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMBLS11_14065
Enzymes [BR:amk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     AMBLS11_14065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3303868..3305433)
Genome map
AA seq 521 aa AA seqDB search
MVVSAFIQSIKALLAKFGVDAPDIRIEGLTLDSREVNTRLAFLAIKGHERDGRDFIPQAI
SLGARVILAQTEDSSAHGQMEMRDHSVIISLYELPQMLSALAAAFYDYPAQKMTTVAVTG
TNGKTSTVQLLTQLKDALGTRSASIGTLGSSVFEGDETQWSNTPAANTTPDAIRMQYLLA
DFVQSEVRHTAFEASSHALVQGRLGTVKTDIAVFTNLTRDHLDYHGTMEEYGKAKRLLLK
QPGLKAVVLNANDDESKKWDGAADKSITRVWTGIDESGLDGSGEIECLREHNNPQSRHCF
ATNASYHAGGCSFELVSSWGSAAISLPLFGKFNISNVLSAIGTLLAEGERFEDVVNAVNA
ITPVPGRMEVFPVTGAANLVVDYAHTPDALEKVLLSAKFHTAGKVWCVFGCGGDRDKGKR
PLMGQAAEVGADAIVITTDNSRSESPESIAEDIIAGLKNRELAVSIPDREQAIRHCLEHA
HESDIIIVAGKGHEDYQIIGDKKTNYNERAVVARLQQEYSK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttagtgcctttattcaaagtataaaagccttattggcgaaatttggtgtagac
gccccagatatccgtattgaaggtttaacgctagacagccgagaagtgaatacacgcttg
gcttttttggcgattaagggccacgaacgcgatggtcgagattttataccccaggcaata
agtttaggggcccgtgtaattctggcgcaaactgaagacagtagtgcccatggtcagatg
gaaatgcgtgaccacagtgtcattatctccttgtatgaattgccacaaatgctttctgca
ttagcagctgcattttatgattatcctgcccagaaaatgacgacggtagcagtcacagga
acaaacggaaaaacctctacagttcaattgcttacccagcttaaggatgcgctgggtact
cgtagcgcaagcattggaacactagggagcagtgtgtttgaaggcgatgaaacccagtgg
tcgaatacgccggcggcaaacactacgcccgatgccatacgtatgcagtatttgttggca
gactttgtgcaaagtgaagtgcgccatacggccttcgaagcaagttctcacgcattggtt
cagggtcggcttggtacagtaaaaaccgatatcgctgttttcactaaccttactcgagat
catctcgattatcacggcaccatggaagagtacggtaaagccaagcgcttgctgcttaag
cagccaggtttaaaggctgtggtattaaacgctaatgatgatgaaagtaagaagtgggat
ggtgccgcagataagtcgattacacgcgtctggacaggtatagacgaaagtggtctggat
ggaagcggtgaaattgagtgcttgcgagagcataacaatcctcaaagtcgccattgtttc
gccacaaatgcttcttatcatgccggtggatgtagttttgaactggtgagctcgtgggga
agcgctgctatttcgctgccgctattcgggaagttcaatatcagcaatgtacttagtgct
ataggtacgttactcgctgaaggtgagcgttttgaagacgtggttaacgcggtaaatgca
atcacgcctgtacccgggcgaatggaagttttccctgtaacgggtgcggctaacttagtg
gtggactacgcgcatacgccagacgctctggagaaagtgctgttaagcgccaaattccat
acagcgggcaaagtgtggtgtgtgtttggctgtggcggagacagagacaaaggtaagcga
ccgttaatggggcaggctgccgaggttggtgctgacgctattgtgatcaccacagataac
agtcgcagtgaaagccctgaatctatcgccgaggatatcattgcgggtttgaagaaccgt
gagctggcagtgtctattcccgatcgcgagcaagctattcgtcattgccttgagcatgcg
catgaaagcgacatcatcattgtggccggaaaaggccatgaagattaccaaattatcggt
gacaaaaagactaactataacgaacgtgcagttgtggcgcgactgcaacaggagtacagc
aaatga

DBGET integrated database retrieval system