KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_14325Help
Entry
AMBLS11_14325     CDS       T02260                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00260  Glycine, serine and threonine metabolism
amk00750  Vitamin B6 metabolism
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01230  Biosynthesis of amino acids
Module
amk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBLS11_14325
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMBLS11_14325
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMBLS11_14325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Trp_DMAT
Motif
Other DBs
NCBI-ProteinID: AFT79434
UniProt: K0D0P8
Position
complement(3362413..3363696)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIDELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISALQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKREQLV
ISVPSGNFGNLTAGMIAKAMGLPIKRFIAATNLNDTVPRYLKTGEWAPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYDALKQ
HMLELLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcaaattttgctgaagccgttaag
cggggcttaggtaaaaaccaagggctttattttccagagcatattcctaccctagacaat
attgacgaattattggaaaagccttttgtcgagcgcagtattgaagtacttcgcgcgctt
attggcgatgagctgaataatggcgagctagaagaaattgttcaaacggcttttgctttt
ggggcaccagttgagcaggtcaacgataacgtatactgcttagagcttttccatggccca
acgcttgcgtttaaagattttggcggccgctttatggcgcaaaccttgtcgcgcattagt
gaagggaagccagtcaccattctaacggcaacttcaggtgatacgggcgcagcggttgca
catgcattccacggtattgacaatatcaacgtggttattttatttccaaagggcaaaatc
agcgcgctacaggaaaagctatttactacgctaggcggaaacatccataccgttgcagta
gagtcagacttcgatgcatgccaatcgttggttaaaaccgcgttcgacgaccctgatgtt
cgcgaaggcctccacctgaactcagcgaactctattaacatcagccgtttattagcccaa
gtgtgctactactttgaagccgtaagtcagttgccaaaagagaagcgcgagcagttagtt
atttcagtacctagcggtaacttcggtaacttaaccgcaggtatgattgctaaagcaatg
gggttgccaattaaacgctttatagcggcaactaacctaaacgatactgtgcctcgctac
cttaaaacgggtgagtgggcgccgaaggcgaccgtggctaccatgtctaacgcaatggat
gttagccagccaaacaactggccgcgtattgaggcccttattgagcgtggttatatcgac
aaagcttgcctaaaaggtgagatggtcgacgaagaatatacgcagcttgctatgcgtcaa
ttggcgcaacagggctataccagcgagcctcatgccgcgattgcctatcgcgcagtaagt
cacgacttagaagacggtgaaattggtttgttcttaggaacagcgcacccggctaagttt
agagaaaccgttgaaaacgtgctaggtaatcctatcagcttaccgaaagcgttggccgat
gtagcaggcgaagacagcttggcggtagacttgccagcgtcttacgacgcgcttaagcag
catatgttggaattgctgaagtaa

DBGET integrated database retrieval system