KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_14915Help
Entry
AMBLS11_14915     CDS       T02260                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMBLS11_14915
   00240 Pyrimidine metabolism
    AMBLS11_14915
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AMBLS11_14915
   03430 Mismatch repair
    AMBLS11_14915
   03440 Homologous recombination
    AMBLS11_14915
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AMBLS11_14915
DNA replication proteins [BR:amk03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AMBLS11_14915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3493817..3494239)
Genome map
AA seq 140 aa AA seqDB search
MPQVIFYQLTSSDNGVAGRASEVIASAFANKQKISVLCDTQSQAEEVDELLWQLPADRFV
PHNLYGEGPQSGTPVEICWLPEQVARRQMVVNVGSGMVPSPNQHRQIIDFVPVDENAKQA
ARVRYKNYQQAGCNMQFKSA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgccacaagtgatattttatcaacttaccagcagtgacaatggcgtggcaggtcgcgct
agtgaagtcattgcctcagcgtttgctaataagcagaaaattagcgttctgtgtgacaca
cagtcgcaagctgaagaagttgatgaattgttatggcagctgccggccgaccgctttgtg
cctcataatctttatggtgaagggccacaatcgggaacgccggtggaaatttgttggctg
ccagagcaggtagccagacgacaaatggtggttaatgtgggttccggtatggtgccttca
cccaaccagcatcgtcaaatcatcgattttgtacccgtggacgagaatgccaaacaggcc
gcgcgggtaagatacaaaaactatcagcaagctggatgcaacatgcagttcaaatctgca
taa

DBGET integrated database retrieval system