KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_15740Help
Entry
AMBLS11_15740     CDS       T02260                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
amk  Alteromonas macleodii Black Sea 11
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3705473..3706582)
Genome map
AA seq 369 aa AA seqDB search
MVSLHFATKTALAVGILLLLASCSTKEDSEFKSQYIAYKALFIDGGRVVDTGNDDVSHSE
GQGYGMLFAVAANDKDTFDALWHWTRRTLMREDGLFSWRYRPCVDNSSSCMDDPNNASDG
EILIAWALLRASEKWGVGSYRDAAKDIVSAVEQKLLVAHNKSVLLLPGEYGFTSEQAGKT
SLQLNLSYWIFPAITDLANLSVTPERWENLYESGLTLLSNMQFSSYRLPSDWVRLTPNES
DRENSLERAALTLDNVISPEFGFNAIRIPLQLSWSPRFRENTALTETLLAPYYAWWAKKP
TPATVNLLTEKPAEYEMSKGMQSVQLAVNSLMQSDDHQRAAWPEINRNMDYYSASLTLLS
MLAVLDNAS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcctgcactttgcaacaaaaacggcgcttgcggtaggtattctcctcttgctc
gcgtcttgttctaccaaggaagatagcgaattcaagtcgcaatacattgcgtataaggca
ttgtttattgatggtgggcgagtggtagacacaggaaatgacgatgtatcgcacagcgaa
gggcaggggtacggaatgctctttgccgtcgccgccaacgacaaagatacctttgacgca
ctgtggcactggaccaggcgcacgctcatgcgcgaagacgggctctttagctggcgctac
cgcccttgtgtggataattcatcctcttgtatggatgaccctaataatgcctctgatgga
gagatcctcattgcatgggcattgctgcgtgcaagtgaaaagtggggtgtaggcagttat
cgagacgctgccaaagatatcgtcagtgcggtggagcagaagttactggtagcgcacaat
aagagcgtgctgctactgcctggcgaatacggctttacttctgaacaggcgggcaaaacc
agtcttcagttaaatctttcctattggattttccccgctataactgatttggccaattta
tcggtaacgccggaacgttgggaaaatctgtatgagtcaggcttaaccttactctcaaat
atgcaattttcatcttatcgattgcccagcgattgggtgcgcttgactcctaatgaatca
gaccgtgaaaatagtttggaacgcgctgcgttaacgctggacaacgtgatatcgcctgag
tttggatttaatgccatccgtattccgctgcagctttcatggtcgccacgatttcgcgaa
aatactgcactaaccgagacgcttcttgcgccatattacgcgtggtgggcaaaaaagcct
acgccagcgacagtcaacctgttaaccgaaaaaccggccgagtatgaaatgtcaaagggg
atgcaatcagttcaacttgccgttaacagcctgatgcaatcagacgatcaccaaagggca
gcgtggcctgaaatcaatagaaacatggattattactcggcaagtttaacgctgctatct
atgttagcagttttggataatgcatcgtga

DBGET integrated database retrieval system