KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_16455Help
Entry
AMBLS11_16455     CDS       T02260                                 

Definition
Phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMBLS11_16455
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AMBLS11_16455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMBLS11_16455
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AMBLS11_16455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3884126..3885844
Genome map
AA seq 572 aa AA seqDB search
MDRRSFIKLSSLAGASVAVSTGLAGCTVNSSANNQPQTDATFTHGVASGDPLKDAVIIWT
RAVPDSGTGSGSGSKSGLAKADILWEMASDAEFANVVSSGMVEAKATHDFTVKVDVTGLS
PARRYFYRFKSANNTSPVGETRTLPEVDVSNVTFGVFSCSNYPAGFFTPYMEAAKDDNID
YVLHLGDYIYEYDGEGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALH
QRKPFIVVWDDHEITNDTYKDGAENHQADEGDFYARRAAAVQAYYEWLPIRPPFGTERLE
IYRQFTFGKLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQARFMKDIGNPNRGLLGET
QRNWLHSSMQQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKAIPDHVHRLANIKRKQKQG
GALSEQELALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTL
KDGTEVGVELATPGVTSPGMEHYLSMDDEMAETLADDLPLLIEDLQYCNLHQRGFMTLTV
SEDRAKATWHYVDAILTKAGKVVNTHSYEIKA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagatcgtttataaagctgtcgtcactcgcaggcgcgagcgtagcagtgtct
acagggctagcgggctgcactgttaactcttcggcaaataaccaaccacaaacggatgcc
acctttactcatggtgtggccagtggagacccattaaaagacgctgttattatctggacg
cgcgccgtgccagactcgggtacaggctcaggctcgggctcaaaatcaggtttagctaaa
gccgatattttgtgggagatggcaagcgatgctgagtttgccaacgttgtaagtagcggc
atggttgaagcgaaagcaacgcatgattttaccgtaaaggtagacgtaacgggtcttagc
cctgctcgtcgttatttttaccgtttcaaaagcgctaataatacaagccctgttggagaa
acccgtacgctacctgaagtcgatgtgtctaacgtcacgttcggcgtattttcctgctct
aactaccctgcgggtttcttcacaccttatatggaagcagcgaaagatgacaacatcgat
tatgtattgcaccttggtgactacatatatgaatacgatggagagggttacgctactgag
cacgccaaggaaattggcagaacctatgcgcctgataacgacaccgagctgtatacgcta
accgactatcgcaatcgctatgcgctataccgaacggatgaaggtttacttgcattacac
caacgtaagccctttatagttgtttgggatgatcatgagattaccaatgacacctataaa
gatggcgctgagaatcaccaagcggatgaaggagatttttatgcccgtcgagctgcggca
gttcaagcttattatgaatggctacccattcgcccaccttttggcaccgagcgcttagaa
atttatcgccagtttacctttggtaaacttcttgatttatacatgctcgacacccgcgtt
cttgcccgcgacaaacagcttgaatacgccaactatcgcgatgctgaaactaaagcgttt
gaccaagcacgctttatgaaagacatcggcaacccgaaccgcggtttacttggtgaaact
caacgcaactggctccattcgtctatgcagcaaagccaggctaaatggcaggtgttaggg
cagcagctattaataggccgcatgcttttccctgtatcaatttttaatggcgttgaacgc
aaagcaatacctgatcatgtacataggctcgcgaatatcaaacgtaaacaaaagcaaggt
ggtgcacttagtgagcaagagcttgcgcttatcaataccgtaatgccttacaacttagac
gcgtgggatggctaccctgttgagcgggaacaggtgctgatgcagcttaagtccatcggc
aagccagttattgcccttgcaggtgatacacataacgcttggcacaacaaattaaccctt
aaagatggcacagaagtgggggttgaacttgctacaccaggcgtaacatcacccggtatg
gaacattatttgagtatggatgatgaaatggcagaaacgcttgccgacgatcttccgctt
ctaattgaagatttgcagtactgtaacctccaccagcgtggctttatgacattgaccgtt
agcgaagaccgcgcaaaagccacgtggcactatgtggatgcaattttaaccaaagctgga
aaagtagttaacacgcatagctatgagattaaggcatag

DBGET integrated database retrieval system