KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_16835Help
Entry
AMBLS11_16835     CDS       T02260                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3968249..3968746
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGVGSNLGDSQGKAQRAFDAIGQIEDTRVLKTSSLYSSKPMGPQDQPDYINAV
CLIETSLKPHGLLKQLQRIELEEGRERKGERWGPRTLDLDILLYGSETIDTADLIIPHYG
MAEREFVMVPLFEIAPNMVMHDGNPISAWVANCSLDGLRRLCSSN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagagcacgtgtacattggtgtaggtagcaaccttggcgatagccaaggaaag
gcacagcgcgcatttgatgctataggtcaaatagaagacactcgcgtacttaaaacctct
tcactttattccagtaaaccgatggggccgcaagaccaacctgactatattaatgcggta
tgcttaattgagacctcgttaaagccacacggattattgaagcaactgcagcgcatagag
ctagaagaaggccgcgagcgcaaaggtgagcgctgggggccgcgcaccttggatttggat
attttgttatacggcagcgaaactatcgataccgcagacttaatcattccccattacggc
atggcagaacgcgagttcgttatggtaccgctgtttgaaattgcgcccaatatggttatg
cacgacggcaaccccatttcagcgtgggtcgccaactgttccctagacggacttcgtcgc
ctgtgctcttccaattag

DBGET integrated database retrieval system