KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_17145Help
Entry
AMBLS11_17145     CDS       T02260                                 

Definition
alternative dihydrofolate reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:amk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4041791..4042498
Genome map
AA seq 235 aa AA seqDB search
MNSPVLITGASQRLGLAMADNLLDQGHHVVVTYRTPRPSITMLKDKGATVLQADFSTEAA
IDRAIDEIKAISKTYRAVIHNASDWAQEKDNSNTHSLIARMMMIHAIAPYRINLALEKAL
CDCEVQSDIIHMTDYVQETGSEKHMAYAASKAALHNLTLSFAKKLAPKVKVNSIAPALLM
FNEGDDDAYKQKAIKKSLLELVPGAQEAVKAMNYLLDSDYMTGQTLHLNGGRHLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcacctgtgcttataacaggcgcaagtcagcgtttaggcttggcaatggccgat
aatttacttgaccaaggccatcacgttgtcgttacgtatcgcacgcctcgcccaagtatc
acaatgctcaaagataagggcgcaacagttttacaggcggattttagcactgaggcggct
attgatcgagcaattgatgagattaaggcaatcagtaaaacctatcgagcggtgatccat
aacgcgtcagattgggcgcaagaaaaagataatagcaacacgcatagtctgattgcgcgc
atgatgatgattcatgccatcgccccgtaccgcataaacttagcactcgaaaaagccctt
tgtgattgtgaagtgcagtctgacattatccatatgactgattacgttcaggaaacaggc
agtgagaagcacatggcttacgctgcaagtaaggcagcgcttcacaacctgaccctatcg
tttgccaagaagctagcaccgaaggtgaaagtaaatagcattgctccggctttgctaatg
ttcaatgagggtgatgatgatgcgtacaagcaaaaggcgataaaaaagtcattgcttgaa
ctcgttcctggggcgcaagaggctgtcaaagccatgaactacttacttgatagcgactac
atgactgggcaaacgcttcatttaaatggcgggcgacatctaaaataa

DBGET integrated database retrieval system