KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_18315Help
Entry
AMBLS11_18315     CDS       T02260                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AMBLS11_18315
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AMBLS11_18315
Transfer RNA biogenesis [BR:amk03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AMBLS11_18315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4311544..4312389
Genome map
AA seq 281 aa AA seqDB search
MPDDAHADLLELAKEIAIEAGEAVLEVYDKGEFDAYQKDDESPVTSADYLANDIINKRLK
AATPDIPILSEENKHASLEERKHWPRYWLIDPIDGTQEFIARSGDFAVNIALIENNEPTI
GVIFWPPGQSLYYAQKGKGAFKSSPDGDHPISVRKLDDPKNSVVMIAISRRQSREKVLSR
MCSKRVYQTLPLGSCSLKACFIAEGKADVFMRIGITGEWDTGASQCIVSEAGGSIAAANF
EPLTYNQRHSLENPDFVVMGDQRVPWQDVVQYDDFVNPHQH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgacgcccatgccgacctactagaacttgcgaaagaaattgccattgaagct
ggtgaagccgtattagaagtgtacgataaaggtgaatttgacgcgtatcaaaaagacgat
gagtctcctgtcaccagcgcagattatttggcaaatgatatcattaataagcgtttaaaa
gcggctacacctgatatccctattctctcggaagagaataaacacgcgagtttagaagag
cgaaagcattggcctcgatattggctgattgatcctatcgacggaacccaagagtttatt
gccagaagcggtgactttgcggttaacattgctcttattgaaaataacgaacccacaata
ggcgttatattttggcctccagggcagtcactctattacgcacagaagggcaaaggggcg
tttaagtcatcacctgatggagatcatccaattagcgtgcgcaaattagacgaccctaaa
aatagtgttgtgatgattgcgattagccgccgccagtctagagaaaaagtattaagcaga
atgtgctccaagcgcgtttaccaaacccttccgctgggtagctgttcactaaaagcgtgt
tttatcgcagaaggaaaggccgatgtattcatgcgcattggcattactggcgaatgggat
actggcgcgtcgcaatgcattgtttctgaggcgggcggaagcattgccgctgccaacttt
gaaccccttacttacaatcagcgtcattcgttagagaacccagattttgtggtaatgggc
gatcaacgcgtgccatggcaagatgttgtccagtatgatgacttcgtaaacccacatcag
cattag

DBGET integrated database retrieval system