KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_18745Help
Entry
AMBLS11_18745     CDS       T02260                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMBLS11_18745
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AMBLS11_18745
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AMBLS11_18745
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AMBLS11_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4424645..4425745)
Genome map
AA seq 366 aa AA seqDB search
MNRFNWQRAVIKVGSALIAPEGNECSGRYLLSLARFITASRDAGKEIILVSSGSVAAGRS
KVKVRHNASIAEKQAMAAIGQNLMMANWQRFFDFPCAQVLLTADDLRDRTRYVNIKNTLR
EILNHQALPIVNENDTVAVNELKVGDNDNLGAYTALVAQADTLIICSDIDGLFTADPRKD
ANATLIPQVDKIDSTIYNLAGGAGTAVGTGGMRTKIEAADKCTSSGIQTLIVNGRKGETF
DTLLEGKVPGTLFNASSTPASARRLWLTHTLKTAGQIEVDSGAKDALVRKGASLLPSGIV
DVTGLFEQGDAVEVVCQGEIIAKGLCLYNAKDLRLIKGKKSKEIANVLGYETTDVAVHRD
DMVLYS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttttaattggcaacgtgccgttataaaagttggcagtgcgcttattgctcct
gaaggcaatgaatgtagtggccgctatctgttgtctcttgcacgatttatcactgcaagc
cgcgacgctggaaaagaaattattcttgtctcatcaggcagtgttgctgcaggccgcagc
aaggtaaaggtgcgccacaatgcgtctattgccgagaagcaggccatggctgcaattggc
caaaatctaatgatggccaactggcagcgctttttcgactttccctgtgcgcaagtttta
ctgaccgcggatgatttgcgtgatagaacccgctacgtaaatatcaaaaataccttacgt
gaaatattgaatcatcaggctttgcctattgtgaatgaaaatgacacggtagccgttaat
gaacttaaagtcggagacaatgacaacttaggcgcctatacggcattagttgcccaagct
gataccttgattatttgttctgatatcgacggcttgtttaccgctgacccaagaaaagat
gccaacgccacactcattccacaggtggataaaatagacagcaccatttacaaccttgca
ggtggcgcgggaactgcggtaggaactgggggtatgcgcacaaaaattgaagcggcagat
aagtgcaccagcagcggtattcaaacccttattgtaaacggacgcaaaggcgaaaccttc
gataccttacttgaaggtaaagtgccgggaacattattcaatgcaagtagcactcccgcc
agtgcgcgcagattgtggcttacccatacgcttaaaactgccggacaaatagaagttgat
agcggtgcaaaagacgccttagtgcgaaaaggcgcgtcattactgccttcgggtattgtt
gatgttaccggtttgtttgaacaaggtgacgctgttgaagtggtgtgccaaggggaaatt
attgccaaggggctttgcttgtataacgcaaaagacttacgccttataaaagggaaaaag
tcgaaagagatagccaatgtgttaggttatgaaaccactgacgttgctgttcaccgagac
gatatggtgctttattcatag

DBGET integrated database retrieval system