KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_18745Help
Entry
AMBLS11_18745     CDS       T02260                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMBLS11_18745
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AMBLS11_18745
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AMBLS11_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4424645..4425745)
Genome map
AA seq 366 aa AA seqDB search
MNRFNWQRAVIKVGSALIAPEGNECSGRYLLSLARFITASRDAGKEIILVSSGSVAAGRS
KVKVRHNASIAEKQAMAAIGQNLMMANWQRFFDFPCAQVLLTADDLRDRTRYVNIKNTLR
EILNHQALPIVNENDTVAVNELKVGDNDNLGAYTALVAQADTLIICSDIDGLFTADPRKD
ANATLIPQVDKIDSTIYNLAGGAGTAVGTGGMRTKIEAADKCTSSGIQTLIVNGRKGETF
DTLLEGKVPGTLFNASSTPASARRLWLTHTLKTAGQIEVDSGAKDALVRKGASLLPSGIV
DVTGLFEQGDAVEVVCQGEIIAKGLCLYNAKDLRLIKGKKSKEIANVLGYETTDVAVHRD
DMVLYS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttttaattggcaacgtgccgttataaaagttggcagtgcgcttattgctcct
gaaggcaatgaatgtagtggccgctatctgttgtctcttgcacgatttatcactgcaagc
cgcgacgctggaaaagaaattattcttgtctcatcaggcagtgttgctgcaggccgcagc
aaggtaaaggtgcgccacaatgcgtctattgccgagaagcaggccatggctgcaattggc
caaaatctaatgatggccaactggcagcgctttttcgactttccctgtgcgcaagtttta
ctgaccgcggatgatttgcgtgatagaacccgctacgtaaatatcaaaaataccttacgt
gaaatattgaatcatcaggctttgcctattgtgaatgaaaatgacacggtagccgttaat
gaacttaaagtcggagacaatgacaacttaggcgcctatacggcattagttgcccaagct
gataccttgattatttgttctgatatcgacggcttgtttaccgctgacccaagaaaagat
gccaacgccacactcattccacaggtggataaaatagacagcaccatttacaaccttgca
ggtggcgcgggaactgcggtaggaactgggggtatgcgcacaaaaattgaagcggcagat
aagtgcaccagcagcggtattcaaacccttattgtaaacggacgcaaaggcgaaaccttc
gataccttacttgaaggtaaagtgccgggaacattattcaatgcaagtagcactcccgcc
agtgcgcgcagattgtggcttacccatacgcttaaaactgccggacaaatagaagttgat
agcggtgcaaaagacgccttagtgcgaaaaggcgcgtcattactgccttcgggtattgtt
gatgttaccggtttgtttgaacaaggtgacgctgttgaagtggtgtgccaaggggaaatt
attgccaaggggctttgcttgtataacgcaaaagacttacgccttataaaagggaaaaag
tcgaaagagatagccaatgtgttaggttatgaaaccactgacgttgctgttcaccgagac
gatatggtgctttattcatag

DBGET integrated database retrieval system