KEGG   Ailuropoda melanoleuca (giant panda): 100463582Help
Entry
100463582         CDS       T01329                                 

Gene name
KCNMB1
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04270  Vascular smooth muscle contraction
aml04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100463582 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100463582 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100463582 (KCNMB1)
Ion channels [BR:aml04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100463582 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB
Motif
Other DBs
NCBI-GeneID: 100463582
NCBI-ProteinID: XP_002922925
Ensembl: ENSAMEG00000004090
UniProt: D2HKP6
Position
Un
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVMCAVIAYYILGTTVLPLYQKSVWTQKSTCHLIETNI
RGQEELGGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDQNQQCSYIPGSLENYQAARADV
EKVRAKFHEIQTFYCFSATRENETTVLYQRLYGPRTLLFSLFWPTFLLTGGLLIIAMVKI
NQSLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcggggagagactcgagccctttgcctgggt
gtggccatggtgatgtgtgccgtcatcgcctactatatcctgggcacgaccgtgctgccc
ctctaccagaaaagcgtgtggacccagaaatccacgtgccatctgattgagaccaacatc
aggggacaggaggagctgggggggaagaaggtgccacagtacccgtgcctttgggtcaat
gtgtcagctgtgggccggtgggctgtgctgtaccacacagaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcctggagaactaccaagcagcccgggccgacgtg
gagaaggtcagggccaaattccacgagatacagactttctactgcttctcagcaactcgg
gagaatgagaccactgtcctataccagcggctctatgggccccggaccctgctcttctct
ctcttctggcccaccttcctgctgaccggaggtctcctcattatcgccatggtgaagatc
aatcagtccctttccatcctggcggctcagaagtag

DBGET integrated database retrieval system