KEGG   Ailuropoda melanoleuca (giant panda): 100463582Help
Entry
100463582         CDS       T01329                                 

Definition
calcium-activated potassium channel subunit beta-1-like
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100463582
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100463582
  Circulatory system
   04270 Vascular smooth muscle contraction
    100463582
Ion channels [BR:aml04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100463582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVMCAVIAYYILGTTVLPLYQKSVWTQKSTCHLIETNI
RGQEELGGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDQNQQCSYIPGSLENYQAARADV
EKVRAKFHEIQTFYCFSATRENETTVLYQRLYGPRTLLFSLFWPTFLLTGGLLIIAMVKI
NQSLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcggggagagactcgagccctttgcctgggt
gtggccatggtgatgtgtgccgtcatcgcctactatatcctgggcacgaccgtgctgccc
ctctaccagaaaagcgtgtggacccagaaatccacgtgccatctgattgagaccaacatc
aggggacaggaggagctgggggggaagaaggtgccacagtacccgtgcctttgggtcaat
gtgtcagctgtgggccggtgggctgtgctgtaccacacagaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcctggagaactaccaagcagcccgggccgacgtg
gagaaggtcagggccaaattccacgagatacagactttctactgcttctcagcaactcgg
gagaatgagaccactgtcctataccagcggctctatgggccccggaccctgctcttctct
ctcttctggcccaccttcctgctgaccggaggtctcctcattatcgccatggtgaagatc
aatcagtccctttccatcctggcggctcagaagtag

DBGET integrated database retrieval system