KEGG   Ailuropoda melanoleuca (giant panda): 100463583Help
Entry
100463583         CDS       T01329                                 

Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100463583
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100463583
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100463583
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100463583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 322 aa AA seqDB search
MSSKSKFIGIIGAPFSKGQPRGGVEEGPAALRKAGLLEKLKEQECDVKDYGDVPFVDVPS
DPPFQIVKNPRSVGKANEQLAGVVAEVKKNGRTSLVLGGDHSMAVGSISGHARVHPDLCV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEEALSYLLGRKKRRIHLSFDVDGLDPSF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LSCFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagtcaaaattcatagggatcatcggagcgcctttctcgaagggccagcca
cgaggaggggtggaagaaggccccgcagcattgagaaaggctggcctgcttgagaaactg
aaagaacaagagtgtgatgtgaaagattacggggacgtgccctttgttgatgtccctagt
gatcctccctttcaaattgtgaagaatccaaggtccgtgggaaaagcgaatgagcagctg
gctggcgtggtggcggaagtcaagaagaatggaaggactagcctggtgctgggcggagac
cacagtatggcggttggaagcatctctggccatgccagggtccacccagatctctgtgtc
atttgggtggacgctcacaccgatatcaacactccactgacaaccacaagtgggaacttg
cacggacaaccggtgtcttttctcctgaaggaactaaaaggaaagatccccgatgtacca
ggattctcctgggtgactccctgcatatctgccaaagatattgtgtatattggcctgaga
gacgtggaccctggggaacactacattttgaaaactctgggtattaaatatttttcaatg
actgaagtggataaactgggaattggcaaggtgatggaagaagccctcagctatctacta
ggaaggaaaaaaaggcgaattcatctgagctttgatgttgatggattggacccatctttc
acaccagctacgggcacaccagttgtgggaggtctgtcttacagagaaggtctctacatt
acagaagaaatttacaaaacagggctactctcaggattagatataatggaagtgaacccc
tctctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttgtcttgctttggagttgcacgggagggtaatcataagccaattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system