KEGG   Ailuropoda melanoleuca (giant panda): 100463820Help
Entry
100463820         CDS       T01329                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100463820
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100463820
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100463820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 524 aa AA seqDB search
MISLFLVLAIGTCLTNSFVPEKEKDAKYWRDQAQQTLKNALRLQKLNTNVAKNVIIFLGD
GMGVSTVTAARILKGQLQHNPGEETSLEMDKFPYVALSKTYNTNAQVPDSAGTATAFLCG
VKTNEGTIGVSAATQRSQCSTAKGNEVTSILHWAKDAGKSVGIVTTTRVNHATPSAAYAH
SAEREWYSDNEMSPEALRQGCKDIAYQLMHNIKDIEVIMGGGRKYMFPKNRTDVEYEMDE
KSRGTRLDGLNLIDTWKSFKPKHKHSHYVWNRTELLTLDPHTVDYLLGLFEPGDLQYELN
RNNVTDPSLSEMVEVAVKILSKNPKGFFLLVEGGRIDHGHHESKAKLALHETVEMDRAIE
KAGAMTSLEDTLTIVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDNKPFTAILYGNGPG
YKVIGGERENIYKVDYAHSNYQAQAAVPLRYETHGGEDVAVFAKGPMAHLLHGVHEQNYI
AHVMGYAACVGANQDHCASASSAGGPSPGPLLLLLTLLPLGTLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatttctctcttcttggtgctggccattggcacctgccttaccaactccttcgtgcca
gagaaagagaaagacgccaagtattggagagaccaagctcagcagaccctgaaaaacgcc
ctcaggcttcagaagctcaataccaacgtggctaagaatgtcatcatatttctgggagat
gggatgggtgtctccacggtgacagccgcccgcatcctcaagggtcagctccagcacaac
cccggggaggagaccagcctggagatggacaagttcccttacgtggccctgtccaagacg
tacaacaccaacgctcaggtccctgacagcgctggcactgccactgccttcttgtgtggg
gtgaagaccaatgagggcaccattggggtgagcgcagccacccagcgtagccagtgcagc
acggctaagggcaacgaggtcacctccatcctgcactgggccaaggacgccgggaaatct
gtgggcattgtgaccaccacgagagtgaaccacgccacccccagtgccgcctacgcccac
tctgctgagcgggagtggtactcagacaacgagatgtccccggaggccctgcgccagggc
tgcaaggacattgcctaccagctcatgcacaacatcaaggacatcgaggtgatcatgggg
ggcggccggaagtacatgttccccaagaatagaactgatgtggagtatgagatggacgag
aagtcccggggcacgaggctggacggcctgaacctcatcgatacttggaagagcttcaaa
ccgaaacacaagcactctcactacgtctggaaccgcaccgaactcctgaccctcgacccc
cacactgtggactaccttttgggtctctttgagccgggggacttgcagtacgagctgaac
aggaacaacgtgacggacccatcactctccgagatggtggaggtagctgtcaagattctg
agcaagaaccccaaaggcttcttcttgctggtggaaggaggcaggattgaccacgggcat
cacgagagcaaggccaagctggcactgcacgagacggtggagatggaccgggcgattgag
aaggcaggcgccatgacctccctggaagacacactgaccatcgtcactgcggaccactcc
cacgtcttcacctttggcgggtataccccccgtggcaactctatctttggtctggccccc
atggtgagcgacacagacaataagcccttcactgccatcctgtacggcaacgggcctggc
tacaaggtcataggcggtgagcgagagaacatctacaaggtggactacgctcacagcaac
taccaggcgcaggccgccgtgcccctgcgctatgagacccatggtggggaggacgtggcg
gtcttcgccaagggtcccatggcgcacctgctgcatggcgtccatgaacagaactacatt
gcccacgtgatgggctacgcggcctgcgtcggtgccaaccaggaccactgtgcctcggcc
agctcggcaggtggcccttctccaggccccctgctcctcctgctgaccctgcttcccttg
ggcaccctattctga

DBGET integrated database retrieval system