KEGG   Ailuropoda melanoleuca (giant panda): 100463829Help
Entry
100463829         CDS       T01329                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B
  KO
K03259  
translation initiation factor 4E
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100463829 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100463829 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    100463829 (EIF4E1B)
   04150 mTOR signaling pathway
    100463829 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100463829 (EIF4E1B)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100463829 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100463829 (EIF4E1B)
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100463829 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 250 aa AA seqDB search
MAATSPAGEAEGGIQKWEEKEEKEEKKDEKEEAAGPVLMAEGALNPPGGLLSQRRKAQDG
GPQEVKLELHPLLNRWALWFFKNDRSRAWQDNLHLVTKFDTVEDFWAMYSHIQLASKLSS
GCDYALFKDGIEPMWEDSRNKRGGRWLVSLAKQQQPCLTILPFWPQLLCLIGESFEEHSP
EVCGAVINIRTKGDKIAVWTREAENQAGVLHIGQVYKERLGLSTKIVIGYQAHADTATKS
NSLAKNKFVV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaccagccctgccggagaggctgagggtggaatccaaaagtgggaggagaag
gaggagaaggaggagaaaaaggacgagaaagaggaggcagcagggccggtgttgatggca
gagggggctctgaatccccctgggggcctgctgtcccagaggaggaaagcccaggatggg
ggcccccaggaggtcaagttggagttacacccgctgctgaacaggtgggctctgtggttt
ttcaagaatgaccgcagccgcgcctggcaggacaacctgcatctggtcaccaagtttgat
actgtggaggacttctgggcgatgtacagtcacatccagctggccagtaagctctcttcc
ggctgtgactacgccctgttcaaggatggcattgagcccatgtgggaagacagcaggaat
aagaggggtggccgctggctggtcagtctcgccaagcagcagcagccatgtctcaccatc
ctccctttttggccccagctgctgtgtctgatcggggagagctttgaggagcatagcccg
gaggtgtgtggggctgtcatcaacatccgaaccaagggggacaagatcgccgtgtggacg
agggaggcagagaaccaggcgggcgtgctgcacattgggcaggtctacaaagagcgcctg
ggcctctccacgaagatagtcattgggtaccaggcccatgcagacacagccaccaagagc
aactctctagccaagaataagtttgtggtgtga

DBGET integrated database retrieval system