KEGG   Ailuropoda melanoleuca (giant panda): 100463925Help
Entry
100463925         CDS       T01329                                 

Definition
acyl-CoA desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100463925
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100463925
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100463925
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100463925
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100463925
Lipid biosynthesis proteins [BR:aml01004]
 Desaturase
  First
   100463925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRILQNGGGNLEKTSLYLEEDIRPEMKDDIYDPSYK
DPEGPKPKVVYVWRNIILMSLLHLGALYGIMLIPTCKIYTCLWGFFYYLISAVGITAGAH
RLWSHRTYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGGLLDLSDLKAEKLVMFQRRYYKPGILLMCFILPTLVPWYFWGE
TFQHSLYVATLLRYAIVLNATWLVNSAAHLYGYRPYDKNINPRENILVSLGAAGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaagaggagatctctagctcctacacaaccaccaccaccatc
acagcgcctccctccaggatcctgcagaatggaggaggcaacttggagaagacttctcta
tacctggaagaagacatccgccctgaaatgaaagatgacatctatgacccaagctacaag
gatccggagggcccaaagcccaaggttgtgtatgtttggagaaacatcatccttatgtct
ctgctacacttgggcgccctgtatgggatcatgttgattcccacctgcaagatctacacc
tgtctctggggattcttctactacctgatcagtgctgtgggcataacggcaggagctcac
cgcctgtggagtcaccggacttacaaagctcggctgccgctgaggctcttcctgatcatt
gccaacacgatggcattccagaacgacgtgtatgaatgggcccgagatcaccgtgcccac
cacaagttttcagaaacagatgctgatcctcacaactcccggcgtggctttttcttctct
cacgtgggttggctgcttgtacgcaaacacccagccgtcaaagagaagggtggtttgcta
gacttgtctgacctaaaagctgagaagctggtgatgttccagagaaggtactacaaaccc
ggcatcctgctgatgtgcttcatcctgcccaccctggtgccctggtacttctggggtgag
acttttcaacatagcttgtacgtcgccactctcttgcgttacgccattgtgctcaatgcc
acgtggctggtgaacagtgctgcccacctctacggatatcggccttatgacaagaacatt
aacccccgagagaatatcctggtttccctgggcgctgcaggggagggcttccacaactac
caccacaccttcccctatgactactctgccagcgagtaccgctggcacatcaacttcacc
accttctttatcgattgcatggctgccctcggtctggcttacgaccggaagaaagtatcc
aaggctgccgtcttggccaggattaaaagaactggagacggaagctacaagagtggctga

DBGET integrated database retrieval system