KEGG   Ailuropoda melanoleuca (giant panda): 100463987Help
Entry
100463987         CDS       T01329                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100463987
  Environmental adaptation
   04710 Circadian rhythm
    100463987
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100463987
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100463987
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100463987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 845 aa AA seqDB search
MLFTVSCSKMSSIVDREDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESITSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGTIQRT
HRPSYDDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPAHEKMAPRRASF
SSQSINPQTVGQSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSTPGLSFGSVQLSSGNSSNIQQLTPINMQGQ
VVQTNQIQSGMNTGHIGTTQHMIPQQTLQSTSSQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPAFAPHQQPPQTLSGTQQQQQGSQEQQLASVPHPSQAQLTQP
PQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQAPQQQHLNRHRTDSLTDPS
KVQPQ
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagaagatggtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctaggaagatggacaagtctactgttctgcagaagagcattgatttt
ttacgaaagcataaagaaatcacagcacagtcagatgccagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagaatttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgaccgatggaagcataatatatgtgtcagagagtataacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
acccctgaatatttaaaatcaaaaaatcagttagaattctgttgtcatatgcttcgagga
acaatagacccaaaggagccatctacctatgaatatgtgaaatttataggaaatttcaaa
tctttaaacagtgtatccacttcagcacacaatggttttgaaggaactatacaacgcaca
cacaggccttcttatgatgatagagtttgttttgtagctactgtgagattagctacacct
caattcatcaaggaaatgtgcactgttgaagaacctaatgaagagtttacatctagacat
agtttagagtggaagttcctatttctagatcacagggcaccacctataataggatatttg
ccatttgaagttctgggaacatcgggctatgattactatcatgtggatgacctagaaaat
ttggcaaagtgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctcaccaagggacaacagtggatttggcttcaaactcattattacatcacttatcat
cagtggaattcaaggccagagtttattgtttgtactcacaccgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgataatcgtataaatacagtcagtctcaaagaagcc
ttggaaaggtttgatcacagcccaaccccttctgcttcctcccggagttcaagaaaatca
tctcacacagcagtctcagacccttcctcaacaccaacaaagatcccaacggacactagc
actcctcccagaccacatttaccagctcatgaaaagatggcgccaaggagggcatcattt
agtagtcagtccataaatccccagactgttggtcagtcgttaacacagccagcgatgtca
caagctgcaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcagtta
ggagccatgcagcatctaaaagaccaattagagcaacggacacggatgatagaagcaaat
attcatcgacaacaagaagaactaagaaaaattcaagaacaacttcaaatggtccatggt
caagggctgcagatgtttttacaacagtcaacccctggtttgagttttggttctgttcaa
ctttcttctggaaattcatctaacatccagcaactcacacctataaatatgcagggccag
gttgttcaaactaatcagattcaaagtggaatgaatactggacacattggcacaactcaa
catatgataccacagcagactttacagagtacatcaagtcagagtcaacaaaatgtactg
agtgggcacagtcaacaaacatctcttcccagtcagacacagagcactctcacagcccca
ctgtataacactatggtaatctcgcagccggcagccggaagcatggtccagattccatct
agcatgccacagaacagtacccagagtgctgcagtaactacattcactcaggacagacag
atcagattttctcaaggtcagcagcttgtgaccaaattagtaactgctcctgtggcttgc
ggggcggtcatggtacctagcacaatgctcatgggtcaggtggtgaccgcctaccctgcc
tttgctccgcaccagcagccgccacagacgctgtcaggcacgcagcagcagcagcagggc
tcccaggaacagcagctcgcttcggttccgcacccatctcaggctcagctgacccagcca
ccgcagcagtttttacagacttcacggttgcttcacgggaatccttcaactcagcttatc
ctctctgctgcatttccactacaacagagcactttccctcagtcacatcaccagcaacac
caggctccgcaacagcagcacctgaatcggcacaggactgacagtttgaccgatccttcc
aaggttcaaccacagtag

DBGET integrated database retrieval system