KEGG   Ailuropoda melanoleuca (giant panda): 100463994Help
Entry
100463994         CDS       T01329                                 

Definition
DNA polymerase delta subunit 4-like
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100463994
   00240 Pyrimidine metabolism
    100463994
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100463994
   03410 Base excision repair
    100463994
   03420 Nucleotide excision repair
    100463994
   03430 Mismatch repair
    100463994
   03440 Homologous recombination
    100463994
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100463994
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100463994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 109 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPEPQPLSVDEAELELLRQFDLAWQY
GPCTGITRLQRWHRAEQMGLEPPPEVRQVLQTHPGDPRFQCSLWHLYPL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccccgtagtgaagaggagggagggcccc
gctgggcacagcaagggggagctggcaccagagctaggggaagagcccgagccccagccc
ttgagcgtggatgaagcagagctggagctgctgaggcagtttgatctcgcctggcagtac
gggccctgcacagggatcacacggctgcagcgctggcatcgggcggagcagatgggtttg
gagcctcccccagaagtgcgtcaggtgctacagacccaccctggagatccccgcttccag
tgcagcctctggcacctctatcccctttga

DBGET integrated database retrieval system