KEGG   Ailuropoda melanoleuca (giant panda): 100463994Help
Entry
100463994         CDS       T01329                                 

Definition
DNA polymerase delta subunit 4-like
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aml00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aml00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:aml03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aml03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aml03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:aml03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aml03440]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:aml05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 109 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPEPQPLSVDEAELELLRQFDLAWQY
GPCTGITRLQRWHRAEQMGLEPPPEVRQVLQTHPGDPRFQCSLWHLYPL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccccgtagtgaagaggagggagggcccc
gctgggcacagcaagggggagctggcaccagagctaggggaagagcccgagccccagccc
ttgagcgtggatgaagcagagctggagctgctgaggcagtttgatctcgcctggcagtac
gggccctgcacagggatcacacggctgcagcgctggcatcgggcggagcagatgggtttg
gagcctcccccagaagtgcgtcaggtgctacagacccaccctggagatccccgcttccag
tgcagcctctggcacctctatcccctttga

DBGET integrated database retrieval system