KEGG   Ailuropoda melanoleuca (giant panda): 100464097Help
Entry
100464097         CDS       T01329                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100464097 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 799 aa AA seqDB search
MSLQIYNDENVTGDKSAENCEFLFSPPELTGRLSVLRLSQKENVPPKSVLKAMKVTFQTP
LRDPQTHRIVSPSMSSKLEAPFALEDTVGLENSPQNRTQKENQQFTKEVDTKMTNGILQK
PTVANASPPPADVRPASEDRQHSSGPTSAHLASLDPSISPQMPESLENQVASLGQTSVSP
EQALEESVHSYFLEKSVTSTSEILEDPSQTAPQDRTEDPPRAVRESSNQVPASSARATLP
PGTHPIGAHGEGPLADLPGEALAGPEDPSGPGNTILVSPLKAGGVMSPSPQKEEADGQRA
TSWSSEPIGLEFDFSDKATSKILPPPGELGKRSGLKPPSRMSEARQEKVPEEADEGPVPL
PRGSYNLDWNQLDDPNFNPFEGGGEAQSPEWPQSGPAGPVAKEPYAGPKASGHLCRSPLF
RQVPSASTDDTPVGQTAARTPSTAGEEEAADRAVLSAPASGLGGEPARPTPPRGPEPASE
PEEEHFRDPAEVLGTGAEVDYLEQFGSSSFKESALRKQSLYLKFDPLLKDSPQRPLPVAL
QTRSAQDMAKPSSGSLPEAKLVELDFLGAPDTPVLDPCPCVFGPGAPPLPVGSIVDVLQY
SQKDMDTAVEAVREENTSLRSRCEALHAKNLEMGKIMDGFEGIVYQAMEEAQKQKELAKA
EIQKVLKEKDQLTADLSSMEKSFSDLFKRFEKQKEVIEGYRMNEESLKKCVGEYIARIEK
EGQRYQALKAHAEEKLQLASEEIAQVRSKAQAEALAFQASLRKEQMRIHSLEKTVEQKTK
ENEELTRICDDLISKMEKI
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatctacaatgatgaaaacgtcaccggtgacaaaagtgcagaaaactgt
gagttcctgttttcaccaccggaacttaccggaagactatctgttcttcgtctgtcacag
aaagaaaatgtgccacccaagagtgtactcaaagctatgaaagtgacttttcagactcct
ctgcgggacccccagacgcaccggatagtaagtcctagcatgagcagcaagctcgaggct
ccttttgctctggaggacactgttggcttagaaaactctcctcaaaaccggacccagaaa
gagaaccaacagttcaccaaggaagttgacaccaaaatgaccaatggaattctccagaaa
ccaacggtggccaatgccagcccccctccagcagatgtgagaccagcctctgaagatagg
cagcattccagtgggcccacctcagctcacctggccagcctggatccctcaatctctccc
cagatgccagaaagtcttgaaaatcaagtggcttctctaggacaaacatctgtgagcccc
gagcaagccttggaggaaagtgttcattcttatttcttagagaaaagtgttacctccacc
tcggaaatcctagaagacccttcccagacggctccccaagaccgaacagaagaccctccc
agagccgtcagagaaagctcgaaccaggtccctgcttcctcagccagggctactttgccc
cctggtactcaccccataggagcacatggagaagggcccctcgcagacctgcctggcgag
gccctggctggccctgaagacccctctggtcctgggaacaccatcctggtcagccctctg
aaggctggaggggtcatgtccccaagtcctcagaaggaagaagctgatggccagagggcc
acctcttggagcagcgagcccatagggctagaatttgatttctctgacaaggccaccagc
aagatattgcccccaccaggggaactggggaagagatccggccttaaacctccctctagg
atgtcagaggcaaggcaggaaaaggtccccgaggaggcagatgagggaccggttcccctt
ccccgggggtcttacaacctggactggaaccagctggatgacccaaactttaacccattt
gaaggtggaggagaggcccagtccccagaatggccccagagcgggccagccgggcctgtg
gccaaggagccatatgctggtcccaaggcctcagggcacttgtgtcggagccctctcttc
aggcaggtgccttcagcctccacggatgacacgcctgtggggcagaccgctgccaggacc
ccgagcacagcaggcgaggaggaagctgcggaccgtgcagttctgtccgctcctgcaagt
ggcctgggcggagagccagcgcgccccactcctccacggggcccagagcctgcctcagag
ccagaggaggaacacttccgagacccagctgaggttctaggcacaggagccgaggtggat
tatctggagcagttcgggagttcctcgtttaaggagtcagccctaaggaagcagtccttg
tacctcaagtttgacccgctcctgaaggacagccctcagagaccgctgcctgtggctctg
cagacccgcagtgcacaggacatggccaagccttcctcaggaagcctgccagaggcgaag
ctagtggaacttgacttcctaggagccccagacactcccgtgctggacccctgtccctgt
gtctttgggcctggggctccaccactgcctgtggggtccatcgtggacgtgctgcagtat
agccagaaggacatggacacagcggtggaggccgtacgtgaggagaacacgtcgctgcgg
agcaggtgtgaggcgctccacgccaagaacctggaaatggggaagataatggacgggttt
gaggggatcgtgtaccaggcgatggaggaggcccagaaacagaaggaacttgcaaaagcg
gagatccagaaggttctgaaggaaaaagaccaactgactgcagatctgagctccatggaa
aagtctttctctgacctcttcaagcggtttgagaaacagaaggaggtgatcgagggctat
cgcatgaatgaagaatcgctgaagaagtgtgtgggggagtacatagcgaggattgagaag
gaaggccagcggtaccaggccctgaaggcccacgcggaggagaagctccagctggccagc
gaggagatcgcccaggtgcgcagcaaggcccaagcggaggccttggccttccaggccagc
ctgaggaaggaacagatgcgcatccattcgctggagaagacagtcgagcaaaagactaag
gaaaatgaggaactgacccgaatctgtgatgatctcatctccaagatggagaagatctga

DBGET integrated database retrieval system