KEGG   Ailuropoda melanoleuca (giant panda): 100464097Help
Entry
100464097         CDS       T01329                                 

Gene name
TACC3
Definition
(RefSeq) transforming, acidic coiled-coil containing protein 3
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100464097 (TACC3)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100464097 (TACC3)
   mRNA cycle factors
    P-body specific factors
     100464097 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 796 aa AA seqDB search
MSLQIYNDENVTGDKSAENCEFLFSPPELTGRLSVLRLSQKENVPPKSVLKAMKVTFQTP
LRDPQTHRIVSPSMSSKLEAPFALEDTVGLENSPQNRTQKENQQFTKEVDTKMTNGILQK
PTVANASPPPADVRPASEDRQHSSGPTSAHLASLDPSISPQMPESLENQVASLGQTSVSP
EQALEESVHSYFLEKSVTSTSEILEDPSQTAPQDRTEDPPRAVRESSNQVPASSARATLP
PGTHPIGAHGEGPLADLPGEALAGPEDPSGPGNTILVSPLKAGGVMSPSPQKEEADGQRA
TSWSSEPIGLEFDFSDKATSKILPPPGELGKRSGLKPPSRMSEARQEKVPEEADEGPVPL
PRGSYNLDWNQLDDPNFNPFEGGGEAQSPEWPQSGPAGPVAKEPYAGPKASGHLCRSPQV
PSASTDDTPVGQTAARTPSTAGEEEAADRAVLSAPASGLGGEPARPTPPRGPEPASEPEE
EHFRDPAEVLGTGAEVDYLEQFGSSSFKESALRKQSLYLKFDPLLKDSPQRPLPVALQTR
SAQDMAKPSSGSLPEAKLVELDFLGAPDTPVLDPCPCVFGPGAPPLPVGSIVDVLQYSQK
DMDTAVEAVREENTSLRSRCEALHAKNLEMGKIMDGFEGIVYQAMEEAQKQKELAKAEIQ
KVLKEKDQLTADLSSMEKSFSDLFKRFEKQKEVIEGYRMNEESLKKCVGEYIARIEKEGQ
RYQALKAHAEEKLQLASEEIAQVRSKAQAEALAFQASLRKEQMRIHSLEKTVEQKTKENE
ELTRICDDLISKMEKI
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatctacaatgatgaaaacgtcaccggtgacaaaagtgcagaaaactgt
gagttcctgttttcaccaccggaacttaccggaagactatctgttcttcgtctgtcacag
aaagaaaatgtgccacccaagagtgtactcaaagctatgaaagtgacttttcagactcct
ctgcgggacccccagacgcaccggatagtaagtcctagcatgagcagcaagctcgaggct
ccttttgctctggaggacactgttggcttagaaaactctcctcaaaaccggacccagaaa
gagaaccaacagttcaccaaggaagttgacaccaaaatgaccaatggaattctccagaaa
ccaacggtggccaatgccagcccccctccagcagatgtgagaccagcctctgaagatagg
cagcattccagtgggcccacctcagctcacctggccagcctggatccctcaatctctccc
cagatgccagaaagtcttgaaaatcaagtggcttctctaggacaaacatctgtgagcccc
gagcaagccttggaggaaagtgttcattcttatttcttagagaaaagtgttacctccacc
tcggaaatcctagaagacccttcccagacggctccccaagaccgaacagaagaccctccc
agagccgtcagagaaagctcgaaccaggtccctgcttcctcagccagggctactttgccc
cctggtactcaccccataggagcacatggagaagggcccctcgcagacctgcctggcgag
gccctggctggccctgaagacccctctggtcctgggaacaccatcctggtcagccctctg
aaggctggaggggtcatgtccccaagtcctcagaaggaagaagctgatggccagagggcc
acctcttggagcagcgagcccatagggctagaatttgatttctctgacaaggccaccagc
aagatattgcccccaccaggggaactggggaagagatccggccttaaacctccctctagg
atgtcagaggcaaggcaggaaaaggtccccgaggaggcagatgagggaccggttcccctt
ccccgggggtcttacaacctggactggaaccagctggatgacccaaactttaacccattt
gaaggtggaggagaggcccagtccccagaatggccccagagcgggccagccgggcctgtg
gccaaggagccatatgctggtcccaaggcctcagggcacttgtgtcggagcccgcaggtg
ccttcagcctccacggatgacacgcctgtggggcagaccgctgccaggaccccgagcaca
gcaggcgaggaggaagctgcggaccgtgcagttctgtccgctcctgcaagtggcctgggc
ggagagccagcgcgccccactcctccacggggcccagagcctgcctcagagccagaggag
gaacacttccgagacccagctgaggttctaggcacaggagccgaggtggattatctggag
cagttcgggagttcctcgtttaaggagtcagccctaaggaagcagtccttgtacctcaag
tttgacccgctcctgaaggacagccctcagagaccgctgcctgtggctctgcagacccgc
agtgcacaggacatggccaagccttcctcaggaagcctgccagaggcgaagctagtggaa
cttgacttcctaggagccccagacactcccgtgctggacccctgtccctgtgtctttggg
cctggggctccaccactgcctgtggggtccatcgtggacgtgctgcagtatagccagaag
gacatggacacagcggtggaggccgtacgtgaggagaacacgtcgctgcggagcaggtgt
gaggcgctccacgccaagaacctggaaatggggaagataatggacgggtttgaggggatc
gtgtaccaggcgatggaggaggcccagaaacagaaggaacttgcaaaagcggagatccag
aaggttctgaaggaaaaagaccaactgactgcagatctgagctccatggaaaagtctttc
tctgacctcttcaagcggtttgagaaacagaaggaggtgatcgagggctatcgcatgaat
gaagaatcgctgaagaagtgtgtgggggagtacatagcgaggattgagaaggaaggccag
cggtaccaggccctgaaggcccacgcggaggagaagctccagctggccagcgaggagatc
gcccaggtgcgcagcaaggcccaagcggaggccttggccttccaggccagcctgaggaag
gaacagatgcgcatccattcgctggagaagacagtcgagcaaaagactaaggaaaatgag
gaactgacccgaatctgtgatgatctcatctccaagatggagaagatctga

DBGET integrated database retrieval system