KEGG   Ailuropoda melanoleuca (giant panda): 100464250Help
Entry
100464250         CDS       T01329                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    100464250 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100464250 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100464250 (GRIA4)
   04728 Dopaminergic synapse
    100464250 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100464250 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100464250 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100464250 (GRIA4)
   05033 Nicotine addiction
    100464250 (GRIA4)
Ion channels [BR:aml04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100464250 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTTIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcagataggtggtctcttcatccgaaacacagatcaggaa
tacacggcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtgaca
aatgctttctgttcccagtattctagaggagtttttgccattttcggactttatgataag
aggtcggtacataccctgacctcattctgcagcgccttacacatctcgctcatcacgccc
agtttccccacggaaggggagagccagttcgtgctgcagctgaggccctccctgcggggg
gcgctcctgagcctgctggatcactacgagtggaactgtttcgtcttcctgtacgacacc
gacagggggtactcaatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgacagacgacaagagaagaaatttgtaatagactgtgagatagaaaggcttcaaaac
atattagaacagattgtgagtgttgggaagcatgtaaaaggctaccattacatcattgca
aacttgggattcaaggatatttctcttgagagatttatacacggtggagcgaatgttaca
ggattccagttggtcgattttaacacacctatggtaaccaaactaatggatcgttggaag
aaactagaccagagagagtatccaggatctgagactcctccaaagtacacatctgctctg
acttatgatggagtccttgtgatggccgaaacgttccgcaatcttagaagacagaaaatt
gatatttcaaggagaggaaatgctggggattgtctggcaaatcctgcggctccctggggc
cagggaattgacatggagaggacgctcaaacaggttcgcattcaaggactgacagggaat
gttcagtttgaccactatggacgcagggtcaattacacaatggatgtgtttgagctgaag
agcacagggcccagaaaggttggttactggaatgatatggataaattggtcttgattcaa
gatgtgcccactcttggcaatgacacggcagctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcacgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaagtacggagcgagggatgcagacacaaag
atctggaatgggatggtgggcgagcttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtccgagaggaggtcattgacttctctaagcccttcatgagtttg
ggcatatcgatcatgatcaaaaagcctcagaaatctaaaccaggagtgttttccttcttg
gatcctctggcctatgagatctggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttgttcctagttagcaggtttagtccatatgagtggcacacagaagagccagaggac
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctttgg
ttttccctgggtgcctttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttataccgct
aacctcgctgctttcctgacggttgagcgaatggtctcccccatagaaagtgcagaagat
ttggccaaacaaacagagattgcctatggaaccctggattcagggtcaacgaaggagttt
ttcagaagatccaaaatagcagtgtatgaaaagatgtggacctacatgcgatccgcagag
ccgtcagtgttcaccaggaccaccgcggagggcgttgctcgggtccgaaaatccaaaggc
aaattcgccttcctcctggagtccactatgaacgagtacatcgagcagcgaaagccgtgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagctacacccaag
ggttcttcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaagtggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagcgccctgagcctgagcaacgtagccggcgtcttctacatt
ctggttggcggcttgggcttggccatgctggtggctctgatagagttctgttacaagtcc
agggcagaggcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtaggtgagaacggccgtgttttgacacccgactgccccaag
gctgtacacacgggaactacaattagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system