KEGG   Ailuropoda melanoleuca (giant panda): 100464347Help
Entry
100464347         CDS       T01329                                 

Definition
cytochrome P450 2B11-like
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:aml00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aml00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:aml00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:aml05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 494 aa AA seqDB search
MELSVLLLLALLMGLLLLLVRGHPKAYGRLPPGPRPLPFLGNVLQMDRRGLLKSFLRLRE
KYGDVFTVYLGPRPAVMLCGIEAIREALVDQAESFSGRGKIAIVEPVFQGYGVVFANGER
WKALRRFSLATMRDFGMGRRSVEERIQEEAQCLVEELRKTQGAFQDPTFFFHSMTANIIC
SIVFGKRFGYRDPEFLRLLDLFYQSFALISSFSSQVFELFHNFLKYFPGTHRQVYKNLQE
INAFIARAVEKHRETLDPNSPQDFIDVYLIRMDKEKADPSSEFHQRNLIYTTLSLFFAGT
ETTSTTLRYGFLLLLKYPHVAERIHKEIDQVIGPHRFPSLDDRAKMPYTDAVIHEMQRFG
DLLPIGVPHMVTKDTCFRGYIIPKGTEVFPILHSALYDPHYFEKPYAFNPDHFLDANGAL
KKNEAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSVASPVAPEDIDLTPRESGVGKV
PPVYQIRFLARGGC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcctcctcctccttgctctcctcatgggactcttgcttctgctggtc
aggggccacccgaaggcctatggccgcctcccgccaggcccccggcctctgcccttcttg
gggaacgttcttcagatggacagaagaggcttactcaaatccttcctcaggctccgagag
aaatacggggatgtcttcacggtgtacctggggccgaggcccgcggtcatgctatgtgga
atagaggccatacgggaggcactggtggaccaagctgagtccttctccggccgtgggaaa
atcgccatagtagagcccgtcttccagggctacggtgtggtctttgccaatggggagcgc
tggaaggcccttcgccgattctctctggccaccatgagggacttcgggatggggaggcgg
agcgtggaggagcggatccaggaggaggctcagtgtctggtggaggagctgcggaaaacg
cagggagccttccaggaccccaccttcttcttccactccatgactgccaacatcatctgt
tctattgtctttggaaaacgctttggctacagagaccctgagttcctgcggctgctggac
ctgttctaccagtccttcgctctcatcagctccttctccagccaggtgtttgagcttttt
cacaacttcttgaagtactttcccggtacacacaggcaagtctacaaaaacctgcaggaa
atcaacgccttcattgcccgcgcggtggagaagcaccgtgaaaccctggaccccaactcg
ccccaggacttcattgatgtctacctgatccgcatggacaaagagaaggccgaccccagc
agcgagttccaccagcggaacctcatctacacgacgctgtcgctcttcttcgctggcacg
gagaccaccagcaccacgctccgctacggattcctgctcctgctcaaatacccccacgtc
gcagagagaatccacaaggagattgaccaggtgattggcccacaccgctttccatccctt
gatgaccgagccaaaatgccatacacggatgcagtcatccatgagatgcagagattcggg
gacctcctcccgattggcgtgccccatatggtcaccaaagacacttgcttcagagggtac
atcattcccaagggcactgaagtatttcccatcctgcactctgctctttatgacccacat
tactttgaaaaaccatatgccttcaaccctgaccactttctggatgccaatggggccctg
aagaagaatgaagcttttatccccttctccatagggaagcgcatttgtctcggggaaggc
atcgcccgcatggagttatttctcttcttcactaccatactccagaacttctctgtggcc
agccccgttgcccctgaggacattgacctcaccccccgggagagtggtgtgggcaaagtg
cccccagtgtaccagatcagatttctggctcgtggaggctgctga

DBGET integrated database retrieval system