KEGG   Ailuropoda melanoleuca (giant panda): 100464347Help
Entry
100464347         CDS       T01329                                 

Definition
cytochrome P450 2B11-like
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100464347
   00590 Arachidonic acid metabolism
    100464347
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100464347
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100464347
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100464347
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100464347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 494 aa AA seqDB search
MELSVLLLLALLMGLLLLLVRGHPKAYGRLPPGPRPLPFLGNVLQMDRRGLLKSFLRLRE
KYGDVFTVYLGPRPAVMLCGIEAIREALVDQAESFSGRGKIAIVEPVFQGYGVVFANGER
WKALRRFSLATMRDFGMGRRSVEERIQEEAQCLVEELRKTQGAFQDPTFFFHSMTANIIC
SIVFGKRFGYRDPEFLRLLDLFYQSFALISSFSSQVFELFHNFLKYFPGTHRQVYKNLQE
INAFIARAVEKHRETLDPNSPQDFIDVYLIRMDKEKADPSSEFHQRNLIYTTLSLFFAGT
ETTSTTLRYGFLLLLKYPHVAERIHKEIDQVIGPHRFPSLDDRAKMPYTDAVIHEMQRFG
DLLPIGVPHMVTKDTCFRGYIIPKGTEVFPILHSALYDPHYFEKPYAFNPDHFLDANGAL
KKNEAFIPFSIGKRICLGEGIARMELFLFFTTILQNFSVASPVAPEDIDLTPRESGVGKV
PPVYQIRFLARGGC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcctcctcctccttgctctcctcatgggactcttgcttctgctggtc
aggggccacccgaaggcctatggccgcctcccgccaggcccccggcctctgcccttcttg
gggaacgttcttcagatggacagaagaggcttactcaaatccttcctcaggctccgagag
aaatacggggatgtcttcacggtgtacctggggccgaggcccgcggtcatgctatgtgga
atagaggccatacgggaggcactggtggaccaagctgagtccttctccggccgtgggaaa
atcgccatagtagagcccgtcttccagggctacggtgtggtctttgccaatggggagcgc
tggaaggcccttcgccgattctctctggccaccatgagggacttcgggatggggaggcgg
agcgtggaggagcggatccaggaggaggctcagtgtctggtggaggagctgcggaaaacg
cagggagccttccaggaccccaccttcttcttccactccatgactgccaacatcatctgt
tctattgtctttggaaaacgctttggctacagagaccctgagttcctgcggctgctggac
ctgttctaccagtccttcgctctcatcagctccttctccagccaggtgtttgagcttttt
cacaacttcttgaagtactttcccggtacacacaggcaagtctacaaaaacctgcaggaa
atcaacgccttcattgcccgcgcggtggagaagcaccgtgaaaccctggaccccaactcg
ccccaggacttcattgatgtctacctgatccgcatggacaaagagaaggccgaccccagc
agcgagttccaccagcggaacctcatctacacgacgctgtcgctcttcttcgctggcacg
gagaccaccagcaccacgctccgctacggattcctgctcctgctcaaatacccccacgtc
gcagagagaatccacaaggagattgaccaggtgattggcccacaccgctttccatccctt
gatgaccgagccaaaatgccatacacggatgcagtcatccatgagatgcagagattcggg
gacctcctcccgattggcgtgccccatatggtcaccaaagacacttgcttcagagggtac
atcattcccaagggcactgaagtatttcccatcctgcactctgctctttatgacccacat
tactttgaaaaaccatatgccttcaaccctgaccactttctggatgccaatggggccctg
aagaagaatgaagcttttatccccttctccatagggaagcgcatttgtctcggggaaggc
atcgcccgcatggagttatttctcttcttcactaccatactccagaacttctctgtggcc
agccccgttgcccctgaggacattgacctcaccccccgggagagtggtgtgggcaaagtg
cccccagtgtaccagatcagatttctggctcgtggaggctgctga

DBGET integrated database retrieval system