KEGG   Ailuropoda melanoleuca (giant panda): 100464417Help
Entry
100464417         CDS       T01329                                 

Definition
cytochrome P450 19A1-like
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100464417
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100464417
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100464417
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP19 family
   100464417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 503 aa AA seqDB search
MVLKMLNPMHYNITSMVPEVMPVATMPILLLTGFLLLVWNYEDTSSIPGPGYCMGIGPLI
SHCRFLWMGIGSACNYYNKMYGEFIRVWICGEETLIISKSSSMFHIMKHSHYSSRFGSKL
GLQCIGMHENGIIFNNNPTLWKAVRPFFTKALSGPGLVRMVTVCVGSIITHLDRLEEVSN
ELGYIDVLTLMRRIMLDTSNILFLGIPLDESAIVVKIQGYFDAWQALLLKPDIFFKISWL
YKKYEKSVKDLKDAMEILIEEKRHRISTAEKLEDHMDFATELIFAEKRGDLTKENVNQCI
LEMLIAAPDTMSVSVFFMLFLIAKHPKVEEAIMKEIQTVIGERDIRIDDMQKLKVVENFI
YESMRYQPVVNLVMRKALQDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLRRFHVQTLQGNCVESLQKKYGLSLH
PDETSNLLEMVFTPRDSEKCLKH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaaaatgctgaacccaatgcattataacatcaccagcatggtgcccgaagtc
atgcctgtggccaccatgccgatcctgctgctcaccggctttcttctcttggtttggaat
tatgaagacacgtcctcaataccaggtcctggctattgtatggggattgggcccctcatt
tcccactgcaggttcctgtggatgggcattggcagtgcctgcaactactacaacaagatg
tatggagaattcatcagagtctggatatgtggggaggaaacgctcattattagcaagtcc
tccagtatgttccacataatgaagcacagtcactacagctcccgattcggcagcaaactt
ggactacagtgcattggcatgcatgaaaacggcatcatattcaacaacaatccaacactc
tggaaagccgttcgacctttcttcaccaaagctttgtctggtcctggccttgtgcgcatg
gtgacagtttgtgttggatccatcataacacatctggacaggctggaggaggtcagcaac
gaactgggttacatcgacgtgctgacccttatgcggcgcatcatgctggacacctcgaac
attctcttcctggggatccccttggacgaaagtgccatcgtggttaaaatccagggttat
tttgatgcatggcaagctctccttctcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgaaaagtctgtcaaggatttgaaagatgccatggaaattctgatagaa
gagaaaagacacaggatttccacagcagagaaactggaagaccatatggattttgccacc
gagttaatttttgccgagaaacgtggtgacctgacaaaagagaatgtgaaccagtgcata
ttggaaatgctgatcgcagcaccagacaccatgtctgtctctgtgttctttatgctattt
ctcattgcaaagcaccctaaggttgaagaggcaataatgaaggagatccagactgttatt
ggtgaaagagatataaggattgatgatatgcaaaaattaaaagtggtggaaaactttatc
tacgagagcatgcggtaccagcctgttgtgaacttggtcatgcgcaaagccttacaggat
gatgtcatcgatggctacccagtgaaaaaggggactaacattatcctgaatattggaaga
atgcatagactcgagtttttccccaagcccaatgaatttactcttgaaaactttgcaaag
aatgttccttacaggtattttcagccatttggttttgggccccgtagctgtgcaggaaag
tacatcgccatggtgatgatgaaagtcgtcctggttacacttctgagacgattccacgtg
cagacattgcaaggaaattgtgttgaaagtttacagaaaaaatatggcttgtccttacac
ccagatgagactagcaacttgctggaaatggtttttaccccaagagattcagaaaagtgc
ctcaaacactaa

DBGET integrated database retrieval system