KEGG   Ailuropoda melanoleuca (giant panda): 100464435Help
Entry
100464435         CDS       T01329                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1-like histone H3K79 methyltransferase
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100464435 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100464435 (DOT1L)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100464435 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1634 aa AA seqDB search
MRHRPSRSRAEVWEKDQHKQEGFPAQVCPRRVQCTVRARPVASSPQEWLAGAGEESAERW
VRGGERRVRAKTPSQAPAPLPPGKGVLQEQVFPKGGVSRVGRGPRAAPHALGRGPAPCIT
GGCKPCPFVFQDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCD
KYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVY
GETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAE
TMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKER
FANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHT
IDRTILENYFSSLKNPKLREEQEAARRRQQRESKSTTTTPTKVPESKAAVPADTPMDSGA
EEEKAGATAIKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMSTANPERKPKKSQTALDLL
HAQAAAQTAAPSPQDAYKSPHSPFYQLPPSVQRHPPDQLLLAPTPPALQKLLESFKIQYL
QFLAYTKTAQYKASLQQLLDQEKEKNARLLGAAQQLFGHCQAQKEEIKRLFQQKLDELGV
KALTYNDLIQAQKEISAHNQQLREQTEQLQKDNRELRSQSLQLLKARCEELKLDWSTLSL
ENLLKEKQALRTQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALAAHLRGK
GSLGRELEADAGRLHLDLDCSKFSLPHFSSASPELSINGHAASYEVCSALSRPSSKQNTP
QYLASPLDQEVVPCTPSHSSRSRLEKMSGLALPDYTRLSPAKLVLRRHLSQDHAASGKTA
AGELHPRAEHAKENGLPYQSPGIANGIKLSPQDPRPSSPVALQMTGERGGEKGLKERAYA
SSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRAEKVRSTPSPVPQTRESSSALEK
QMGTNAHSAGSKSLAPAPAGFYTGSVAVSGALAGSPAPLAPGAESSAFDEVSGSGSLFAS
VGSCSSTPQHPPLLPQSRGSGTASPAHPLCASPRLSSATQGPLPEASKGDFPSETGFSDP
EGEAKRRIVFTISAGGSGAKQSPPSKPSPLPTGARGDSGQGHGSDSRKRGRRKRAAAGTP
SLSSSVSPKRRALPSVAGLFTQSSGSPLNLNSMVSNINQPLEITAISSPESLKSSPVPYQ
DNDQPPVLKKEKPLSQTNGAHYSPLTSDEEQGSEDEPGSARIERKIATISLESKSPPKTL
ESGGSLAGRKPTPAGEPANSSKWKSTFSPISDLGLAKCADSPLQAGSALSQNSLFTFRPP
LEEPGLADAKLAAHPRKSFPGALSGAGGLSPSSNPPNGFAFSGGLAADLSLHSFSDGASL
SHKVPEAASLGAPLSFPAPRGKEGSATEPGAFVNKRQLDGLGGPKGREAGELGLPACGPP
DKVSLTHSKPGKGRDREPDLKNGHNLFISAATVPPGGLLSGPGLATVASSTVSAAPSAQT
HRPFLGTFAPGPQFALGPMSLQANLGSSVLQSLFSSVPAAAGLVHVSSAATRLTNSHAMG
SFSSGVAGGAVGGN
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacagacccagccggtcgagagcggaggtctgggagaaggaccagcacaaacag
gagggctttccagcgcaggtgtgtccccgcagggtccagtgcacagtcagagccaggcct
gtggcttccagcccgcaggagtggctggcgggggcgggtgaggagtcagcagagcggtgg
gtgaggggtggggagaggagggtcagggcaaagactccatcccaggcccctgccccactg
cctcctgggaagggagtgctgcaggagcaggtcttccccaagggtggtgtgtcccgcgtg
ggcaggggtcccagagcagcacctcacgccctgggccggggccccgcaccctgcatcact
ggagggtgtaaaccctgtccctttgtctttcaggacaaacaccacgatgctgctcatgaa
atcatcgagaccatccgatgggtctgtgaagagatcccggacctcaagcttgcgatggag
aattatgttctcatcgactacgacaccaaaagctttgaaagcatgcagaggctctgtgac
aaatacaaccgtgccatcgacagcatccaccagctgtggaaggggaccacgcagcccatg
aaactgaacacgcggccgtccaacgggctcctgcggcacatcctgcagcaggtctacaac
cactcggtgacggaccctgagaagctcaacaactacgagcccttctccccggaggtgtac
ggagagacctcctttgacttggtcgcgcagatgatcgatgagatcaagatgaccgaggat
gacctgtttgtggacctgggcagtggagtgggccaggtcgtgctgcaggtcgccgcggca
accaactgcaagcatcactatggcgtggagaaagccgacatcccagccaagtacgcggag
accatggaccgagagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatac
acactggaaagaggcgacttcctctcggaagagtggagagagcggattgccaacacaagt
gttatatttgtgaataattttgcctttggtcctgaggtggatcaccagctgaaggagcgg
tttgcgaacatgaaggaaggtggcagaatcgtttcctcgaagccctttgcgcctctgaac
ttcagaataaacagcagaaacttgagtgacatcggcaccatcatgcgcgttgtggagctc
tcgcccctgaaaggctcggtgtcctggacggggaagccggtctcttactacctgcacacc
atcgaccgcaccatacttgaaaactatttttctagtctgaaaaacccaaaactcagggag
gaacaggaggcagctcggcgcaggcagcagcgagagagcaagagcaccacgaccactccc
accaaggtgcccgaaagcaaggctgccgtgcccgcggacaccccgatggattccggggct
gaggaagaaaaggctggggcgactgccatcaaaaagccgtccccctccaaagcccggaag
aagaagctgaacaagaaggggcggaagatggccggccggaagcgcgggcgtcccaagaag
atgagcactgcgaaccccgagcgtaagcccaagaagagccaaactgcactggacctcctg
cacgcccaggccgcggcgcagacggcagcgccctcgccgcaggatgcgtacaagtcacct
catagcccgttttaccagctacctcccagtgtgcagcggcacccccccgaccagctgctg
ctggcacccaccccgcccgcactgcagaagctgctagaatccttcaagattcagtacttg
cagttcttggcatataccaagaccgcccagtacaaggccagcctgcagcagctgctggac
caggagaaggagaagaacgcgcggttgctaggcgctgcccagcagctgtttggccactgc
caggcccagaaagaggagatcaagaggcttttccagcagaaactggatgagctgggagtg
aaggcgctgacctacaacgacctgatccaggcgcagaaggagatctcggctcacaaccag
cagctgagggagcagacggagcagctgcagaaggacaacagggagctgaggagccagagc
ctgcagctgctcaaggctcggtgtgaggagctgaagctggactggtccacgctgtccctg
gagaacctgctgaaggagaagcaggccctgcggacccagatctccgagaagcagcggcac
tgcctggagctgcagataagcatcgtggagctggagaagagccagcggcagcaggagctc
ctgcagctcaagtcctgcgtgccgccggacgatgccctggcggcacacctgcgagggaaa
ggctccctgggccgggagctggaggccgacgccggccggctgcacctcgacctggactgc
tccaagttctctctgccccacttcagcagcgcgagcccagaactctccataaacggccat
gcggccagctacgaggtctgcagtgcgctgagccggccctcgtccaagcagaacaccccc
cagtacctggcctcccccctggaccaggaagtcgtaccctgcacgcccagccacagcagc
cgctcgaggctcgagaagatgtcgggcctggccttgcccgactacacccggctctcccca
gccaagctggtgctgaggcgtcacctgagccaggaccacgcggccagtggcaagactgcg
gctggcgagctgcacccgcgagctgagcacgccaaggagaacggccttccgtaccagagc
cctggcatcgcaaatggcatcaagctgagccctcaggaccctcgaccttcatcccccgtg
gccttacagatgacaggggagaggggcggcgagaagggtttgaaggagcgtgcctacgcc
agcagcggggaggccatcaccagcctgcccgtcagcatcccgctcagcaccgtgcagccg
agcaagctgcccgtcagcatccctctggccagtgtggtgctgcccagccgcgccgagaaa
gtgagaagcacccccagccctgtgccgcagacccgagagtcctcgtccgcacttgaaaag
cagatgggcacgaatgcccacagtgctggaagcaaaagcctcgccccagctcctgcaggc
ttctacactggctcggtggccgtcagtggggccctggcaggcagcccggcccccctcgct
cctggagccgagtccagcgcctttgacgaggtctccggctcaggaagcctgttcgccagc
gtggggtcctgcagctctaccccacagcacccgcccctgctgccgcagtcccgcggctct
ggcacggcctcacctgcccatccactctgcgccagcccccggctcagcagtgccacccag
ggcccgctccccgaggccagcaaaggggactttccgtccgagaccggcttctccgacccc
gagggcgaagccaagaggagaatcgtctttaccatctcagctggcggcagtggtgccaag
cagtcacctcccagcaaacccagccctctgcccacgggtgcccgcggggacagcggccag
ggccacgggtcggacagtcgcaagcggggcaggaggaagcgggcggcggccgggaccccc
agcctgagctccagcgtgtcgcccaagcgtcgggccctgccgtccgttgccggcctcttc
acgcagtcgtcagggtccccactgaacctcaactcgatggtcagcaacattaatcagcct
ttggaaatcacggccatctcgtcccccgagagcctgaagagctcccctgtcccctaccag
gacaacgaccagccgcccgttctcaagaaggagaagcccttgagccagaccaacggggcc
cactactccccactgacctcagacgaggagcaaggctccgaggacgagccgggcagcgcc
agaatcgagagaaaaattgcaacaatctccttagaaagcaaatctcctccgaaaaccttg
gaaagtggtggtagcctggccggcaggaagccgacccctgccggtgagcccgccaacagc
agcaagtggaaatccaccttctcgcccatctccgacctcggcctggccaagtgtgccgac
agcccgctgcaggccggctctgccctgagccagaactccctgttcactttccggcccccc
ctagaggagcccggcttggccgatgccaagctggctgcccaccccaggaaaagctttccc
ggtgcgctgtcgggggccggtgggctgagccccagcagcaaccctcccaatggcttcgcc
ttcagcgggggcctggccgccgacctcagtttacacagcttcagcgatggtgcttctctc
tcccacaaggttcccgaggccgccagcctgggtgcccccctgagcttccccgccccgcgg
ggcaaggagggcagtgccacagagcccggcgcctttgtgaacaagaggcagctggacgga
ctgggaggcccaaagggcagggaggcaggcgagctgggcctgccggcgtgcgggccccca
gacaaggtctcgctgacgcacagcaagccaggcaagggccgggaccgtgagcccgacttg
aagaacggccacaacctcttcatttctgccgccactgtgcctcccgggggcctcctcagt
ggcccgggcctcgccacggtggcgtcctcgacagtcagcgcggccccctctgcccagact
caccgccccttcctgggcacctttgcccctggcccgcagttcgccctgggtcccatgtcc
ctgcaggccaatctgggctcgtccgtgctacagtccttgttcagctccgtgccagccgcc
gccggcctggtgcacgtctcgtccgccgcgaccagactgaccaactcgcacgccatgggc
agcttctcctccggggtggcaggcggcgctgttggaggtaactag

DBGET integrated database retrieval system