KEGG   Ailuropoda melanoleuca (giant panda): 100464486Help
Entry
100464486         CDS       T01329                                 

Gene name
MOS
Definition
(RefSeq) v-mos Moloney murine sarcoma viral oncogene homolog
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100464486 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100464486 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    100464486 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100464486 (MOS)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100464486 (MOS)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100464486 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 375 aa AA seqDB search
MLPFFAGPFSFLFTYLSHSGVHFEGAMPSPLPRRSYLPSVFSPSVDSRPCSSPSELPSKA
GKLFLGGTPPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSK
CTKNRLASQRSFWAELNIARLRHDNIVRVVAASTHTPAGFNSLGTIIMEFGGNVTLHQAI
YDAASCPEEEGVQPHCCAGEQLNLEKCLKYSLDIVNGLLFLHSQNIVHLDLKPANILISE
QDVCKIGDFGCSEKLEDLLCFQTPPYPLGGTYTHRAPELLKGETLTPKADIYSFAITLWQ
MATKEAPYSGERQYVLYAVVAYHLRPSLSAAVFTDSISGKRLEKIIQCCWRACALQRPSA
ELLLVDLNSLRAEFD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcttccctttttcgcgggccctttttcttttcttttcacttacctgagccactctggg
gtccactttgaaggcgcgatgccctcgcctcttcccaggcgcagttacctccccagtgtg
ttttctccctcggtggactcccggccctgcagcagcccttccgagctccccagtaaggca
gggaagctcttcctgggtggcactccccccagggccccacggctaccacgccggctggcc
tggtgctccatcgactgggaacaggtgtgcctcctgcagaggctgggagctggcgggttt
ggctctgtgtacaaggcgacttaccacggtgttccggtggccataaagcaagtgagcaag
tgcaccaagaaccgactggcatcccagcgcagtttctgggctgagctcaacatcgcaaga
cttcggcacgataacatcgtgcgggtcgtggctgccagcacgcacacgcctgcgggcttt
aacagcctaggcaccataatcatggagtttggtggcaatgtcacgttacaccaagccata
tatgatgccgccagctgccccgaggaggagggcgtgcagcctcactgttgtgccggagag
caactaaatctggaaaagtgtctaaagtattccctagatattgtaaatggcttgcttttc
cttcactcgcaaaacatcgtacacttggacctgaagccggctaacattctgatcagtgag
caggatgtctgcaaaattggtgactttggttgctccgagaagctggaagatctgctgtgc
ttccagactcctccttaccccctcgggggcacctacacccatcgagccccagagctcctc
aaaggagagaccctaacgcccaaagctgacatctattcctttgccatcactctctggcaa
atggctaccaaggaggcgccttactcaggcgagcggcagtacgtgctctacgcggtggtg
gcctatcatctccgtccgtctctgtcagcagctgtcttcactgactccatctctgggaaa
agactagagaagatcatccaatgctgttggagggcctgtgctttgcagcggccaagtgca
gaactcctcctggttgaccttaactccttacgagctgaatttgactga

DBGET integrated database retrieval system