KEGG   Ailuropoda melanoleuca (giant panda): 100464486Help
Entry
100464486         CDS       T01329                                 

Definition
proto-oncogene serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100464486
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100464486
  Cell growth and death
   04114 Oocyte meiosis
    100464486
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100464486
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100464486
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100464486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 349 aa AA seqDB search
MPSPLPRRSYLPSVFSPSVDSRPCSSPSELPSKAGKLFLGGTPPRAPRLPRRLAWCSIDW
EQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSKCTKNRLASQRSFWAELNIARLRHDNI
VRVVAASTHTPAGFNSLGTIIMEFGGNVTLHQAIYDAASCPEEEGVQPHCCAGEQLNLEK
CLKYSLDIVNGLLFLHSQNIVHLDLKPANILISEQDVCKIGDFGCSEKLEDLLCFQTPPY
PLGGTYTHRAPELLKGETLTPKADIYSFAITLWQMATKEAPYSGERQYVLYAVVAYHLRP
SLSAAVFTDSISGKRLEKIIQCCWRACALQRPSAELLLVDLNSLRAEFD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcctcttcccaggcgcagttacctccccagtgtgttttctccctcggtggac
tcccggccctgcagcagcccttccgagctccccagtaaggcagggaagctcttcctgggt
ggcactccccccagggccccacggctaccacgccggctggcctggtgctccatcgactgg
gaacaggtgtgcctcctgcagaggctgggagctggcgggtttggctctgtgtacaaggcg
acttaccacggtgttccggtggccataaagcaagtgagcaagtgcaccaagaaccgactg
gcatcccagcgcagtttctgggctgagctcaacatcgcaagacttcggcacgataacatc
gtgcgggtcgtggctgccagcacgcacacgcctgcgggctttaacagcctaggcaccata
atcatggagtttggtggcaatgtcacgttacaccaagccatatatgatgccgccagctgc
cccgaggaggagggcgtgcagcctcactgttgtgccggagagcaactaaatctggaaaag
tgtctaaagtattccctagatattgtaaatggcttgcttttccttcactcgcaaaacatc
gtacacttggacctgaagccggctaacattctgatcagtgagcaggatgtctgcaaaatt
ggtgactttggttgctccgagaagctggaagatctgctgtgcttccagactcctccttac
cccctcgggggcacctacacccatcgagccccagagctcctcaaaggagagaccctaacg
cccaaagctgacatctattcctttgccatcactctctggcaaatggctaccaaggaggcg
ccttactcaggcgagcggcagtacgtgctctacgcggtggtggcctatcatctccgtccg
tctctgtcagcagctgtcttcactgactccatctctgggaaaagactagagaagatcatc
caatgctgttggagggcctgtgctttgcagcggccaagtgcagaactcctcctggttgac
cttaactccttacgagctgaatttgactga

DBGET integrated database retrieval system