KEGG   Ailuropoda melanoleuca (giant panda): 100464499Help
Entry
100464499         CDS       T01329                                 

Gene name
PPP1CA
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, alpha isozyme
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100464499 (PPP1CA)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100464499 (PPP1CA)
   04024 cAMP signaling pathway
    100464499 (PPP1CA)
   04022 cGMP - PKG signaling pathway
    100464499 (PPP1CA)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100464499 (PPP1CA)
  Cell growth and death
   04114 Oocyte meiosis
    100464499 (PPP1CA)
  Cellular commiunity
   04510 Focal adhesion
    100464499 (PPP1CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100464499 (PPP1CA)
  Endocrine system
   04910 Insulin signaling pathway
    100464499 (PPP1CA)
   04921 Oxytocin signaling pathway
    100464499 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100464499 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100464499 (PPP1CA)
  Nervous system
   04728 Dopaminergic synapse
    100464499 (PPP1CA)
   04720 Long-term potentiation
    100464499 (PPP1CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100464499 (PPP1CA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100464499 (PPP1CA)
  Substance dependence
   05031 Amphetamine addiction
    100464499 (PPP1CA)
   05034 Alcoholism
    100464499 (PPP1CA)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100464499 (PPP1CA)
  Infectious diseases
   05168 Herpes simplex infection
    100464499 (PPP1CA)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100464499 (PPP1CA)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100464499 (PPP1CA)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100464499 (PPP1CA)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100464499 (PPP1CA)
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100464499 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggaaagaatgtacagctaacagagaacgagatccgtggtctgtgcctc
aaatcacgggagattttcctgagccagcccattcttctggaactggaggcacccctcaag
atctgcggtgacatccatggccagtactacgaccttctgcggctatttgagtatggcggc
ttccctccagagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ttggagaccatctgcctgctgctggcctataagatcaagtaccctgagaacttcttcctg
ctccgtgggaaccacgaatgtgccagcatcaaccgcatctacggcttctatgatgagtgc
aagagacgctacaacattaaactgtggaaaacctttaccgactgcttcaactgcctgccc
attgctgccattgtggacgagaagatcttctgctgccacggaggcctgtccccagacttg
caatccatggagcagattcggcgtatcatgcggcccacagatgtgcctgaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgtggtgtctcctttacctttggggctgaggtagtggccaagttcctgcacaagcacgac
ttggacctcatctgccgggcgcaccaggtggtggaagatggctatgagttctttgccaag
cggcagctggtgacactgttctcggctcccaactactgtggcgagtttgacaacgcaggc
gccatgatgagtgtcgatgagacgctcatgtgctccttccagatcctcaagcccgctgac
aagaacaaggggaaatacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaagtag

DBGET integrated database retrieval system