KEGG   Ailuropoda melanoleuca (giant panda): 100464499Help
Entry
100464499         CDS       T01329                                 

Definition
serine/threonine-protein phosphatase PP1-alpha catalytic subunit-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100464499
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100464499
   04022 cGMP - PKG signaling pathway
    100464499
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100464499
  Cell growth and death
   04114 Oocyte meiosis
    100464499
  Cell communication
   04510 Focal adhesion
    100464499
 Organismal Systems
  Immune system
   04611 Platelet activation
    100464499
  Endocrine system
   04910 Insulin signaling pathway
    100464499
   04921 Oxytocin signaling pathway
    100464499
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100464499
   04270 Vascular smooth muscle contraction
    100464499
  Nervous system
   04728 Dopaminergic synapse
    100464499
   04720 Long-term potentiation
    100464499
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100464499
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100464499
  Substance dependence
   05031 Amphetamine addiction
    100464499
   05034 Alcoholism
    100464499
  Infectious diseases
   05168 Herpes simplex infection
    100464499
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100464499
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100464499
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100464499
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100464499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggaaagaatgtacagctaacagagaacgagatccgtggtctgtgcctc
aaatcacgggagattttcctgagccagcccattcttctggaactggaggcacccctcaag
atctgcggtgacatccatggccagtactacgaccttctgcggctatttgagtatggcggc
ttccctccagagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ttggagaccatctgcctgctgctggcctataagatcaagtaccctgagaacttcttcctg
ctccgtgggaaccacgaatgtgccagcatcaaccgcatctacggcttctatgatgagtgc
aagagacgctacaacattaaactgtggaaaacctttaccgactgcttcaactgcctgccc
attgctgccattgtggacgagaagatcttctgctgccacggaggcctgtccccagacttg
caatccatggagcagattcggcgtatcatgcggcccacagatgtgcctgaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgtggtgtctcctttacctttggggctgaggtagtggccaagttcctgcacaagcacgac
ttggacctcatctgccgggcgcaccaggtggtggaagatggctatgagttctttgccaag
cggcagctggtgacactgttctcggctcccaactactgtggcgagtttgacaacgcaggc
gccatgatgagtgtcgatgagacgctcatgtgctccttccagatcctcaagcccgctgac
aagaacaaggggaaatacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaagtag

DBGET integrated database retrieval system