KEGG   Ailuropoda melanoleuca (giant panda): 100464500Help
Entry
100464500         CDS       T01329                                 

Gene name
PDIA6
Definition
protein disulfide isomerase family A, member 6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aml04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 432 aa AA seqDB search
MSCTFFLAANGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKV
ATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAAL
SALRQLVKDRLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVWMVEFYAP
WCGHCKNLEPEWAAAATEVREQTKGKVKLAAVDATVNQLLASRYGIRGFPTIKIFQKGES
PVDYDGGRTRSDIISRALDLFSENAPPPELLEIISEDIAKKTCEEHQLCVVAVLPHILDT
GAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMK
FALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPAISVREPWDGKDGELPVEDDIDLS
DVELDDLEKDEL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaccttcttcctggcagcgaatggtctctattcctccagcgatgatgtgatt
gaactaactccaacaaatttcaaccgagaagttattcagagtgatagcttgtggcttgta
gaattctatgctccatggtgtggccactgccagaggttgacaccagaatggaagaaagtg
gcaactgcattaaaagatgttgtaaaagttggtgcagttgacgcagataaacatcagtct
ctaggaggccagtacggcgttcaggggtttcccaccattaagatttttggctccaacaaa
aacagaccagaagattatcagggtggcagaaccggtgaagccattgtagatgctgccctc
agtgccctgcgccagctcgtcaaggatcgccttggggggaggggtggcggatatagttct
ggaaagcaagggaggagtgaaagttcaagtaagaaggatgtggttgagctgacggacgac
agcttcgataagaacgttcttgatagtgacgatgtttggatggttgaattctatgctcct
tggtgtggacactgcaaaaacctcgagccagaatgggctgctgcagctacagaggtaaga
gagcaaacgaagggaaaggtgaagctcgcagccgtggacgccaccgtcaaccagctgcta
gccagccggtacgggattaggggatttcctacaatcaagatctttcagaagggagagtct
cctgtggattatgatggggggcggacacgatctgacattatctcccgagccctggatttg
ttttctgagaatgccccgcctcctgagctgctggagatcatcagtgaggacatcgccaag
aagacgtgtgaggagcatcagctctgtgtcgtggccgtgctgccccatattctggatact
ggagctgctggcagaaattcttacttagaagttcttctaaagttggcagacaaatacaaa
aagaaaatgtgggggtggctgtggaccgaagctggagcccagtcggaacttgaaaacgca
ttggggattggagggtttggataccctgccatggcagccattaatgcacgcaagatgaaa
tttgctcttctgaaaggatctttcagcgagcaaggcattaatgagtttctcagggagctc
tctttcggccgcggctctacggcccccgtgggaggcggggctttccccgccatcagcgtc
agagagccttgggacggcaaggacggcgagcttcccgtggaagatgacattgacctcagt
gacgtggagctggacgatttggaaaaagatgagctgtga

DBGET integrated database retrieval system