KEGG   Ailuropoda melanoleuca (giant panda): 100464500Help
Entry
100464500         CDS       T01329                                 

Gene name
PDIA6
Definition
(RefSeq) protein disulfide isomerase family A, member 6
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100464500 (PDIA6)
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100464500 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 534 aa AA seqDB search
MTQEINAVWIAQGHRARGKKSFPICSSRDESVASVSYLLWSAPGGVRFQGPQEQQAGVSA
GGQKDPDPGGRWAIGEDSRCRVCCQSVNPFAHAVLRVIPAGLMSCTFFLAANGLYSSSDD
VIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVKVGAVDADKH
QSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRGGGY
SSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATE
VREQTKGKVKLAAVDATVNQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIISRAL
DLFSENAPPPELLEIISEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADK
YKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLR
ELSFGRGSTAPVGGGAFPAISVREPWDGKDGELPVEDDIDLSDVELDDLEKDEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagagataaatgctgtgtggattgcccagggtcacagggcacgaggtaagaaa
tcttttcccatttgcagctcaagagatgagagtgtggcctctgtgtcctacttgctgtgg
tctgcaccagggggagtgagattccaggggccacaagagcaacaagcaggggtgtctgct
gggggtcagaaggaccctgacccgggaggacgttgggcaattggagaagactcccgttgc
cgagtttgctgccagagcgtgaacccttttgctcatgctgtgcttcgtgtcattcctgca
ggtctcatgagctgcaccttcttcctggcagcgaatggtctctattcctccagcgatgat
gtgattgaactaactccaacaaatttcaaccgagaagttattcagagtgatagcttgtgg
cttgtagaattctatgctccatggtgtggccactgccagaggttgacaccagaatggaag
aaagtggcaactgcattaaaagatgttgtaaaagttggtgcagttgacgcagataaacat
cagtctctaggaggccagtacggcgttcaggggtttcccaccattaagatttttggctcc
aacaaaaacagaccagaagattatcagggtggcagaaccggtgaagccattgtagatgct
gccctcagtgccctgcgccagctcgtcaaggatcgccttggggggaggggtggcggatat
agttctggaaagcaagggaggagtgaaagttcaagtaagaaggatgtggttgagctgacg
gacgacagcttcgataagaacgttcttgatagtgacgatgtttggatggttgaattctat
gctccttggtgtggacactgcaaaaacctcgagccagaatgggctgctgcagctacagag
gtaagagagcaaacgaagggaaaggtgaagctcgcagccgtggacgccaccgtcaaccag
ctgctagccagccggtacgggattaggggatttcctacaatcaagatctttcagaaggga
gagtctcctgtggattatgatggggggcggacacgatctgacattatctcccgagccctg
gatttgttttctgagaatgccccgcctcctgagctgctggagatcatcagtgaggacatc
gccaagaagacgtgtgaggagcatcagctctgtgtcgtggccgtgctgccccatattctg
gatactggagctgctggcagaaattcttacttagaagttcttctaaagttggcagacaaa
tacaaaaagaaaatgtgggggtggctgtggaccgaagctggagcccagtcggaacttgaa
aacgcattggggattggagggtttggataccctgccatggcagccattaatgcacgcaag
atgaaatttgctcttctgaaaggatctttcagcgagcaaggcattaatgagtttctcagg
gagctctctttcggccgcggctctacggcccccgtgggaggcggggctttccccgccatc
agcgtcagagagccttgggacggcaaggacggcgagcttcccgtggaagatgacattgac
ctcagtgacgtggagctggacgatttggaaaaagatgagctgtga

DBGET integrated database retrieval system