KEGG   Ailuropoda melanoleuca (giant panda): 100464757Help
Entry
100464757         CDS       T01329                                 

Gene name
CLTC
Definition
(RefSeq) clathrin, heavy chain (Hc)
  KO
K04646  
clathrin heavy chain
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100464757 (CLTC)
   04142 Lysosome
    100464757 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100464757 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    100464757 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100464757 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100464757 (CLTC)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100464757 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAICNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtata
aacccagcaaacattggcttcagtacactaactatggagtcagacaaattcatctgcatt
agagagaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccggctagcaaagtaatt
gcattaaaagctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcaccttctggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcattggagtatggaaggagagtctcaaccagtaaaa
atgtttgatcgccattctagccttgcagggtgccagattatcaattatcgtacagatgca
aagcaaaagtggttacttctgactggcatatctgcacagcaaaatcgtgtggtgggagct
atgcagttatattctgtagataggaaagtgtctcagcccattgaaggacatgcggctagc
tttgcgcagtttaaaatggaaggaaatgcagaagaatcaacgttgttttgttttgcagta
cggggtcaagcaggagggaagttacatatcattgaagttggcacaccacctacaggaaac
cagccctttccaaagaaggcagtggatgttttcttccctccagaagcacaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtagtgttcttgattactaagtatggc
tatatccacctctatgatcttgagacgggtacctgtatctacatgaatagaatcagtgga
gaaacaatctttgttactgcacctcatgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtatgtgtggaagaagaaaacataattccttatatcaccaat
gtcctacaaaatcctgatttggctctgagaatggctgtacgtaacaacttagctggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcagaggca
gcaaaggtagctgctaatgcaccaaagggaatccttcgtaccccagatactatccgtcgg
ttccagagtgtcccagcccagccaggtcaaacttctcctctacttcagtactttggaatc
cttttggaccagggtcagctaaacaaatatgaatccttagaactatgtaggcctgtactt
cagcaagggcggaaacagcttttggagaaatggttaaaagaagataagctggaatgttca
gaagaactgggtgaccttgtgaaatctgtggaccctacattggcacttagtgtgtacctg
cgggctaatgtcccaaataaagtcattcagtgctttgcagaaacaggtcaagtccagaag
attgttttatatgctaaaaaagttggatatactccagactggatatttctgctgagaaat
gtcatgcgtatcagtccagatcagggacagcagtttgcccaaatgttagttcaggatgaa
gaacctcttgctgatatcacacagattgtagacgtctttatggaatacaatctaattcaa
cagtgtacagcattcttgcttgatgccctgaagaataatcgcccatctgaaggtccttta
cagacacggttgcttgagatgaaccttatgcatgcgcctcaagttgcagatgctattcta
gggaatcagatgttcacgcattatgaccgggctcatatcgctcagctgtgtgaaaaggct
ggtctactgcagcgtgcattagaacacttcactgatttatatgacataaagcgtgcagtt
gttcacacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagtc
gaagactccctagaatgcctcagggccatgctgtctgccaatattcgtcagaatctgcag
atctgtgttcaggtggcttcgaaatatcatgaacaactgtcaactcaatctctgattgaa
ctttttgaatctttcaagagttttgaaggtctcttttattttctgggatccattgttaac
tttagtcaggacccagatgtgcactttaagtatattcaggcagcttgcaagactgggcag
atcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtcaag
aattttctcaaggaagcaaagctaacagatcagttaccacttatcattgtatgtgatcga
tttgactttgtccatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gagatatatgtacaaaaggtgaatccaagtcgacttcctgtggttattggaggattgctt
gatgttgattgctctgaagatgtcattaaaaacttgattcttgttgtaagaggtcaattc
tctactgatgagcttgttgctgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaacgcattagcc
aaaatctacatagacagtaataacaacccagagagatttcttcgtgaaaatccttattat
gacagtcgcgttgttggaaagtattgtgagaagagagatccacatctggcctgtgttgct
tatgaacgtggccagtgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttcccggtatttggtacgccgaaaggatccagaattatggggtagtgtgctg
ctggaaagcaatccttacaggagacccctaattgaccaggttgtacagacagctttgtct
gagactcaggaccctgaagaagtgtcagtaactgtcaaggctttcatgactgcagacctt
cctaatgaactcattgaactgctggaaaaaattgtccttgataactctgtattcagtgaa
cacaggaatcttcaaaaccttctcatcctcactgcaatcaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgccccagatattgccaatattgccatc
tgcaatgagttgtttgaagaagcatttgccattttccggaaatttgatgtcaatacttca
gcagttcaggtcttgattgagcatattggaaatttggatcgggcgtatgaatttgctgaa
cgctgcaatgaacctgcagtctggagtcagcttgcaaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttatatcaaagcagatgatccttcatcctacatggaagtt
gttcaggctgccaacactagtggaaactgggaagaactagtgaagtacttgcagatggcc
cgtaagaaggctcgtgagtcctatgtggagacagaattgatatttgccctggctaaaaca
aaccgccttgcagagttagaagagttcatcaatgggccaaataatgctcatatccaacaa
gttggcgaccgttgttatgatgaaaaaatgtatgatgctgctaagttattatacaataac
gtttccaattttggacgcttggcatctactctggttcacctgggtgaatatcaggcagct
gttgatggagctaggaaagctaacagtactcgaacatggaaagaggtctgcttcgcctgt
gtagatggcaaggagttccgtcttgctcagatgtgtgggcttcatatagtagtacatgca
gatgaattggaggaacttatcaactactatcaggatcgaggatattttgaagaactgata
accatgttggaagcagcactgggacttgagcgagctcatatgggaatgtttaccgaatta
gctattctgtattctaaatttaagccacagaaaatgagagagcacctggagctgttctgg
tccagagtgaatattcctaaggtgcttagagctgcagaacaagctcatctttgggcagaa
ttggtgtttttgtatgacaagtatgaagaatatgataatgccataattactatgatgaat
catccaactgatgcatggaaagaagggcagttcaaagatatcattaccaaggttgccaat
gtagaactgtactacagagcaatacagttctacttagaattcaagcctctgttgttaaat
gatttgctgatggtgctgtctccccggttggatcatactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaagccatatttgcgttcagttcaaaaccacaataac
aaatctgtgaatgaatcactgaacaacctctttattacagaagaagattatcaggctttg
cgaacatcaatagatgcttatgacaactttgacaatatctcacttgctcagcgtttggaa
aaacatgaacttattgagttcagaagaattgctgcttatctcttcaaagggaacaatcgc
tggaaacagagtgtagagctgtgcaagaaagatagcctgtacaaggatgcaatgcagtat
gcctctgaatctaaagatactgagttggctgaagaactcctacagtggtttttgcaggaa
gaaaaaagagagtgctttggagcttgtctttttacctgttatgatcttttaaggccagac
gttgtcctggaaactgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaggaatacttgacaaaggtggataaattagatgcttcggaatcgctacga
aaagaagaagaacaagctacagagactcaacctattgtttatggtcagccccagttgatg
ttgacagcaggacccagtgttgcagtccctccccaggcaccttttggctatggttatact
gcaccaccctatgggcagccacagcctggctttggatacagcatgtga

DBGET integrated database retrieval system