KEGG   Ailuropoda melanoleuca (giant panda): 100464757Help
Entry
100464757         CDS       T01329                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100464757
   04142 Lysosome
    100464757
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100464757
  Nervous system
   04721 Synaptic vesicle cycle
    100464757
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100464757
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100464757
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100464757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAICNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtata
aacccagcaaacattggcttcagtacactaactatggagtcagacaaattcatctgcatt
agagagaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccggctagcaaagtaatt
gcattaaaagctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcaccttctggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcattggagtatggaaggagagtctcaaccagtaaaa
atgtttgatcgccattctagccttgcagggtgccagattatcaattatcgtacagatgca
aagcaaaagtggttacttctgactggcatatctgcacagcaaaatcgtgtggtgggagct
atgcagttatattctgtagataggaaagtgtctcagcccattgaaggacatgcggctagc
tttgcgcagtttaaaatggaaggaaatgcagaagaatcaacgttgttttgttttgcagta
cggggtcaagcaggagggaagttacatatcattgaagttggcacaccacctacaggaaac
cagccctttccaaagaaggcagtggatgttttcttccctccagaagcacaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtagtgttcttgattactaagtatggc
tatatccacctctatgatcttgagacgggtacctgtatctacatgaatagaatcagtgga
gaaacaatctttgttactgcacctcatgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtatgtgtggaagaagaaaacataattccttatatcaccaat
gtcctacaaaatcctgatttggctctgagaatggctgtacgtaacaacttagctggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcagaggca
gcaaaggtagctgctaatgcaccaaagggaatccttcgtaccccagatactatccgtcgg
ttccagagtgtcccagcccagccaggtcaaacttctcctctacttcagtactttggaatc
cttttggaccagggtcagctaaacaaatatgaatccttagaactatgtaggcctgtactt
cagcaagggcggaaacagcttttggagaaatggttaaaagaagataagctggaatgttca
gaagaactgggtgaccttgtgaaatctgtggaccctacattggcacttagtgtgtacctg
cgggctaatgtcccaaataaagtcattcagtgctttgcagaaacaggtcaagtccagaag
attgttttatatgctaaaaaagttggatatactccagactggatatttctgctgagaaat
gtcatgcgtatcagtccagatcagggacagcagtttgcccaaatgttagttcaggatgaa
gaacctcttgctgatatcacacagattgtagacgtctttatggaatacaatctaattcaa
cagtgtacagcattcttgcttgatgccctgaagaataatcgcccatctgaaggtccttta
cagacacggttgcttgagatgaaccttatgcatgcgcctcaagttgcagatgctattcta
gggaatcagatgttcacgcattatgaccgggctcatatcgctcagctgtgtgaaaaggct
ggtctactgcagcgtgcattagaacacttcactgatttatatgacataaagcgtgcagtt
gttcacacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagtc
gaagactccctagaatgcctcagggccatgctgtctgccaatattcgtcagaatctgcag
atctgtgttcaggtggcttcgaaatatcatgaacaactgtcaactcaatctctgattgaa
ctttttgaatctttcaagagttttgaaggtctcttttattttctgggatccattgttaac
tttagtcaggacccagatgtgcactttaagtatattcaggcagcttgcaagactgggcag
atcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtcaag
aattttctcaaggaagcaaagctaacagatcagttaccacttatcattgtatgtgatcga
tttgactttgtccatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gagatatatgtacaaaaggtgaatccaagtcgacttcctgtggttattggaggattgctt
gatgttgattgctctgaagatgtcattaaaaacttgattcttgttgtaagaggtcaattc
tctactgatgagcttgttgctgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaacgcattagcc
aaaatctacatagacagtaataacaacccagagagatttcttcgtgaaaatccttattat
gacagtcgcgttgttggaaagtattgtgagaagagagatccacatctggcctgtgttgct
tatgaacgtggccagtgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttcccggtatttggtacgccgaaaggatccagaattatggggtagtgtgctg
ctggaaagcaatccttacaggagacccctaattgaccaggttgtacagacagctttgtct
gagactcaggaccctgaagaagtgtcagtaactgtcaaggctttcatgactgcagacctt
cctaatgaactcattgaactgctggaaaaaattgtccttgataactctgtattcagtgaa
cacaggaatcttcaaaaccttctcatcctcactgcaatcaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgccccagatattgccaatattgccatc
tgcaatgagttgtttgaagaagcatttgccattttccggaaatttgatgtcaatacttca
gcagttcaggtcttgattgagcatattggaaatttggatcgggcgtatgaatttgctgaa
cgctgcaatgaacctgcagtctggagtcagcttgcaaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttatatcaaagcagatgatccttcatcctacatggaagtt
gttcaggctgccaacactagtggaaactgggaagaactagtgaagtacttgcagatggcc
cgtaagaaggctcgtgagtcctatgtggagacagaattgatatttgccctggctaaaaca
aaccgccttgcagagttagaagagttcatcaatgggccaaataatgctcatatccaacaa
gttggcgaccgttgttatgatgaaaaaatgtatgatgctgctaagttattatacaataac
gtttccaattttggacgcttggcatctactctggttcacctgggtgaatatcaggcagct
gttgatggagctaggaaagctaacagtactcgaacatggaaagaggtctgcttcgcctgt
gtagatggcaaggagttccgtcttgctcagatgtgtgggcttcatatagtagtacatgca
gatgaattggaggaacttatcaactactatcaggatcgaggatattttgaagaactgata
accatgttggaagcagcactgggacttgagcgagctcatatgggaatgtttaccgaatta
gctattctgtattctaaatttaagccacagaaaatgagagagcacctggagctgttctgg
tccagagtgaatattcctaaggtgcttagagctgcagaacaagctcatctttgggcagaa
ttggtgtttttgtatgacaagtatgaagaatatgataatgccataattactatgatgaat
catccaactgatgcatggaaagaagggcagttcaaagatatcattaccaaggttgccaat
gtagaactgtactacagagcaatacagttctacttagaattcaagcctctgttgttaaat
gatttgctgatggtgctgtctccccggttggatcatactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaagccatatttgcgttcagttcaaaaccacaataac
aaatctgtgaatgaatcactgaacaacctctttattacagaagaagattatcaggctttg
cgaacatcaatagatgcttatgacaactttgacaatatctcacttgctcagcgtttggaa
aaacatgaacttattgagttcagaagaattgctgcttatctcttcaaagggaacaatcgc
tggaaacagagtgtagagctgtgcaagaaagatagcctgtacaaggatgcaatgcagtat
gcctctgaatctaaagatactgagttggctgaagaactcctacagtggtttttgcaggaa
gaaaaaagagagtgctttggagcttgtctttttacctgttatgatcttttaaggccagac
gttgtcctggaaactgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaggaatacttgacaaaggtggataaattagatgcttcggaatcgctacga
aaagaagaagaacaagctacagagactcaacctattgtttatggtcagccccagttgatg
ttgacagcaggacccagtgttgcagtccctccccaggcaccttttggctatggttatact
gcaccaccctatgggcagccacagcctggctttggatacagcatgtga

DBGET integrated database retrieval system