KEGG   Ailuropoda melanoleuca (giant panda): 100464801Help
Entry
100464801         CDS       T01329                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100464801 (USP9X)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100464801 (USP9X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2554 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLSMALNP
HCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPVIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFIVRFPNQGRQVD
DLDVWSHTNDTIGSVRRYILNRIKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPAGAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTSVNQVTHDQAVVLQS
ALQSIPNPSSECMLRNVSIRLAQQISDEASRYMPDICVIRAIQKIIWASGCGALQLVFSP
NEEITKIYEKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINIPNAEVLLNNEIDWLKRIRDDVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PQQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQNEQSESETAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERLDTIDQGDELIRYISELAITTRPHQ
IIMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPGQDHLLPEAEEI
TMISIQLAARFLFTTGFHTKKIVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRF
SEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAV
LNLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVSLDEGPGPPIKY
QYAELGKLYSVVSQLIRCCNVSSRMQSSINGNPPLPNPFGDPNLSQPIMPIQQNVADILF
VRTSYVKKIIEDCSNSEETVKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLL
LQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPV
AYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERS
HSARMTLAKACELCPEEEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTG
PAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
NT seq 7665 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagtaggagggaatgacagccagggccaggctcct
gatggacagtctcagccccccctccagcagaatcagacttcatcgcctgattcttccaat
gaaaattccccggcaactcccccagatgaacaaggtcaaggtgatgccccaccacagctt
gaagatgaggaacctgcatttccacatactgacctggcaaagttagatgacatgattaat
aggcctcgatgggtggttccagttttgccgaaaggggaattagaagtgcttttagaagct
gctattgatcttagtaaaaaaggccttgatgttaaaagtgaagcatgtcagcgatttttc
cgagatgggctaacaatatcattcactaaaatccttacagatgaggcagtgagtggctgg
aagtttgaaattcataggtgtattatcaacaatactcatcgcctggtggagctatgtgtg
gccaagttgtcccaagactggtttccacttctagaacttctctccatggccttaaatcct
cattgcaaattccatatctacaatggtacacgtccgtgtgaatccgtttcctcaagcgtt
cagctgcctgaagatgaactctttgcgcgttctccagatcctcgatcaccaaaaggttgg
ctggtggatcttctcaacaagttcggcactttaaatgggttccagattttgcatgatcgt
tttattaatggatcagcattaaatgttcaaataattgcagcccttattaaaccatttggg
caatgctatgagtttctcactcttcatacagtgaaaaagtactttcttccagtaatagaa
atggttccacagtttttagaaaacttaaccgatgaagagctgaaaaaagaagcaaagaat
gaagccaaaaatgatgctctttcaatgattattaaatctttgaagaatttagcttcaagg
gttccaggacaagaagaaactgtaaaaaatttagaaatattcaggttaaaaatgatactt
agattactgcaaatttcgtctttcaatggaaagatgaatgcactgaatgaggttaataag
gtgatatctagtgtgtcttactatactcatcggcatggtaaccctgaggaggaagagtgg
ctcacagctgaacgaatggcagaatggatacagcagaacaatatcttatccatagtactg
cgagatagtctccatcaaccacagtatgtagaaaagctagagaagattcttcgttttgtc
atcaaagaaaaagctctgactttacaagatcttgataatatctgggcagcacaggcaggg
aagcatgaagccattgtgaagaatgtacatgatctactggcaaagttagcgtgggatttt
tctcctgaacaacttgatcatctttttgattgctttaaggccagttggacaaatgcaagt
aaaaagcagcgtgaaaagctacttgagctgatacgtcgccttgcagaagatgataaagat
ggtgtgatggcacacaaagtgctgaacctactgtggaacctggcccacagtgatgatgta
cctgtagacatcatggacctggctctcagtgcccacataaaaatactagattatagttgc
tcacaggaccgtgacacacagaagatccagtggatagatcgctttatagaagaacttcgt
acaaatgacaaatgggtaattcctgcactgaaacaaattagagaaatttgtagtttgttt
ggtgaagcccctcaaaatttgagtcaaactcagcgaagtccccatgtattttatcgccat
gacttaatcaatcaacttcagcacaatcatgccctagttactttggtagcagaaaacctt
gcaacttatatggaaagcatgaggctgtatgctagagatcatgaagactatgacccccaa
actgtgaggctgggaagtagatacagtcatgttcaagaagtccaagaacggcttaacttc
cttagatttttattgaaggatggccagctgtggctctgtgctcctcaggcaaaacaaata
tggaaatgcttagcagagaatgcagtttacctttgtgatcgtgaagcctgctttaagtgg
tattccaagttgatgggggatgaaccagacttggatcctgatattaataaagacttcttt
gaaagtaatgtgcttcagcttgatccttctctgttaactgagaatggaatgaaatgtttt
gagcgattcttcaaagctgtgaattgtcgagaaggaaaactagtagcaaaaaggagagca
tatatgatggatgatttggagttaataggattagactacctttggagggtcgtgattcaa
agtaatgacgatattgccagcagagctatagatctccttaaagagatatatacaaacctt
ggtccgaggctacaggtgaatcaggtggtgatccacgaagacttcattcagtcttgcttt
gatcgtttgaaagcctcttatgacacattgtgtgttttggatggtgacaaagacagtatt
aattgtgcaaggcaggaagctgttcgaatggttcgagtattaactgtgttaagggagtac
ataaatgaatgtgacagtgattaccacgaggaaagaacaattctacctatgtcaagagct
ttccgtggtaaacacctctcttttatagttagatttccaaaccaggggagacaagttgat
gacttggatgtatggtctcatacaaatgatacgatcggttcagtaagacgatatatcctc
aatcgtattaaagccaatgtagctcatacaaaaattgagctttttgtgggcggtgaactg
atagatcctgcagacgacagaaagttgattggacaattaaacttaaaggataaatcgcta
ataacagccaaacttacacaaataagttccaatatgccttcaagccctgatagctcttct
gattcctcaactgggtctcctggaaaccatggtaatcattacagtgatggtcccaatcca
gaagtggaaagctgtttgcctggggtgatcatgtcactgcatcccagatacatctctttc
ctttggcaagttgcagacttgggtagcagcctaaatatgccgcctcttagagatggagca
agagtacttatgaaacttatgccaccagatagcacaacaatagaaaaattaagagctatt
tgtttagaccatgccaaacttggagaaagcagccttagtccatctcttgactcgcttttc
tttggtccttcagcctcacaagtgctatacctaacagaggtggtctatgccttgttaatg
cctgccggtgcacctctggctgatgattcctctgattttcaatttcactttttgaaaagt
ggtggcctaccccttgtcctgagcatgctaaccagaaataacttcctaccaaatgcagat
atggaaactcgaaggggtgcttacctcaatgctcttaaaatagccaaattgttgttaact
gccattggctatggccatgttcgagctgtggcagaagcttgtcagccaggtgtagaaggc
gtgaatcccatgacatcggtcaaccaagttactcatgatcaagccgtggtgctacaaagt
gcccttcagagcattcctaatccatcatctgaatgcatgcttagaaatgtgtccattcgt
cttgcccagcaaatatctgatgaggcttcaagatatatgcctgatatctgtgtaattaga
gctattcaaaaaatcatctgggcatcaggatgcggggcattacagctagtatttagccca
aatgaagaaatcactaaaatttatgagaagaccaatgcaggcaatgagccagacttggaa
gatgaacaggtttgctgtgaagcattggaagtgatgacgttatgttttgccttgatcccg
acagccttggatgctcttagtaaagaaaaggcttggcagacattcattattgacttactg
ttgcactgtcacagcaaaactgttcgccaggtggcacaggagcagttctttttaatgtgc
accagatgttgcatgggacacaggcctctacttttcttcattactctgctctttaccgtg
ttggggagcacagccagagagagagctaagcattcgggcgactacttcaccctcttaaga
caccttcttaattacgcttacaatagtaatataaacatacccaatgctgaagttcttctc
aataatgaaattgattggcttaagagaattagggatgatgttaaaagaacaggtgaaacc
ggtgttgaagagacgatcttggaaggccaccttggggtaacaaaagaattactggccttt
cagactcctgagaaaaagtatcacattggttgtgaaaaaggaggtgctaatctcattaaa
gaattaattgatgatttcatctttcctgcatccaatgtttacctgcaatatatgagaaac
ggagagctgcccgctgaacaggcaattccagtctgtagctccccagccaccattaacgct
ggttttgagttacttgtagcattagctgttggctgcgtgaggaatctcaaacagatagta
gattctttgactgaaatgtattatattggcacggcaataactacttgtgaagcacttaca
gagtgggaatatctgccacctgttggaccccgcccacctaaaggatttgtggggctgaaa
aatgctggtgctacttgttacatgaattctgtgattcagcaactgtacatgattccctcc
atcaggaacggtattcttgcaattgaaggcacaggtagtgatgtagatgatgatatgtct
ggggatgagaagcaggacaatgagagcaatgttgatcccagagatgatgtatttggatat
cctcaacaatttgaagacaaaccagcattaagtaaaacagaagataggaaagaatataat
attggagttctaaggcaccttcaagtcatctttggtcatttggcggcttctcgactacag
tactatgtgcccagaggattttggaaacagttcaggctttggggtgagcctgttaatctg
cgtgaacagcatgatgctttagagttttttaattcattggtggatagtttagatgaagct
ttgaaagccttaggacacccagctatgctaagtaaagtcttaggaggttcctttgctgat
cagaagatttgccagggctgcccacatagatacgagtgtgaagaatcttttacgactttg
aatgtagacattagaaatcaccaaaatcttcttgattctttggaacagtatgtcaaagga
gatttattagaaggtgcaaatgcatatcattgtgaaaaatgcaataaaaaggttgatact
gtaaagcgcttgctaattaaaaaattacctcctgttcttgctatccaactgaaacgattc
gactacgactgggaaagagaatgtgcaatcaaattcaatgattattttgaatttcctcga
gagctggacatggaaccttacacagtcgcaggtgttgcaaagctggaaggagataatgta
aacccagagagtcagttgatacagcagaatgagcagtctgaaagtgagacggcaggaagc
acgaaatacagacttgtgggtgtgctggtgcacagcggccaagcaagtgggggacattat
tattcttacatcattcagaggaatggtggagatggtgagagaaatcgctggtataaattt
gatgatggagatgtaacagagtgtaaaatggatgacgatgaagaaatgaaaaaccagtgt
tttggcggagagtacatgggagaggtatttgatcacatgatgaaacgcatgtcatacagg
cgccagaaaaggtggtggaatgcttacatacttttttacgaacgactggacaccatagac
cagggtgatgagttgataagatacatatctgaacttgctatcaccacaagaccccatcag
attattatgccatcagccatcgagagaagtgtacggaagcagaatgtgcaattcatgcat
aaccgaatgcagtacagtctggaatattttcagttcatgaaaaaattgcttacatgtaat
ggtgtttacttaaatcctccaccagggcaagatcacctgttgcctgaagcagaagaaatc
actatgattagtattcagcttgctgctaggttcctttttaccacaggatttcacaccaag
aaaatcgtccgtggctctgccagtgattggtatgatgcattgtgtattctccttcgtcac
agcaagaatgtccgtttttggtttgctcacaatgtcctttttaatgtttcgaatcgcttt
tctgaatatcttctggagtgccccagtgcggaagtaaggggtgcatttgcaaaacttata
gtttttattgcacatttttccttgcaagatgggccatgtccttcaccttttgcatctccc
ggaccttctagtcaggcttatgacaacttaagcctaagcgatcacctactaagggcagtt
ctcaatctcttgagaagggaagtttcagagcatgggcgtcatttgcagcagtatttcaat
ctgtttgtaatgtatgccaatttaggtgtggcggagaagacacaacttctgaaattgaat
gtacctgctacctttatgcttgtgtctttagatgaaggcccaggtcctccaatcaaatac
cagtatgctgaattaggcaaattgtactcagttgtgtcacagctaatccgctgttgcaat
gtgtcttcaagaatgcagtcttcaatcaatggtaatcctcctcttcccaatccttttggt
gatcctaatttatcacagcctataatgccaattcagcagaatgtggcagacattttattt
gtgagaacaagttatgtgaagaaaatcattgaggactgcagtaactcagaggaaactgtc
aaattgcttcgtttttgctgctgggagaatcctcagttctcatctactgtcctcagtgaa
cttctctggcaggttgcatattcctacacttacgaactccggccctatttggatctgctt
ttgcaaatcttactgattgaggactcctggcagactcacagaattcataatgcacttaaa
ggaatcccagatgaccgagatgggctgtttgacacaatccagcgctctaagaatcactat
caaaaaagagcataccagtgtataaaatgtatggtagctctttttagcaactgtcctgtt
gcctaccagattctgcagggcaatggagatcttaaaagaaagtggacctgggcagtggaa
tggcttggagatgaacttgaaagacgaccatatactggcaaccctcagtacacttataac
aactggtctcctccagtgcagagcaatgaaacatcaaatggttatttcttggagagatca
catagtgctaggatgacacttgcaaaagcttgtgaactctgtccagaggaggagccagat
gaccaagatgccccagatgagcatgagtcacctccacctgaagatgccccgttgtacccc
cactcacctgggtctcagtatcaacagaataatcatgtgcatggacagccatatacaggc
ccagcagcacatcacatgaacaaccctcagagaactggccaacgagcacaagaaaattat
gaaggcagtgaagaagtatccccacctcagacgaaggatcagtga

DBGET integrated database retrieval system