KEGG   Ailuropoda melanoleuca (giant panda): 100465011Help
Entry
100465011         CDS       T01329                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 679 aa AA seqDB search
MGDSSMDASTTVSETVAEEVSLFSMTDMILFSLIVGVLTYWLLFRKKKDEIPEFTKIQPV
TSSVKDSSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLG
DLGSLPEIENSLAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFGLGNKTYEH
FNAMGKYVDKRLEQLGAQRIFELGMGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDLDPAKVYVGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHL
MHLELDISDSKLRYESGDHVAVYPANDSTLVSQLGEILGADLDVVMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEQLRKMASSSGEGKELYLSWV
VEARRHILAILQDYPSLRPPIDAQPVELLPRLQARYYSIASSSKVHPNSVHICAVAVEYE
TKSGRVNKGVATSWLRAKEPAGENGRRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAP
FIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAAFHRDGSLTQLNVAFSREQ
PHKVYVQHLLKRDKEHLWQLIHEGGAHIYVCGDARNMARDVQNTFYDIVAEGGTMAHAQA
VDYIKKLMTKGRYSLDVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccagcatggatgccagcaccaccgtgtctgagacagtggcagaagaagtg
tctctcttcagtatgacggacatgattctgttttccctcatcgtgggcgtcctgacctac
tggctcctcttcagaaagaaaaaagacgaaatcccggagttcaccaaaattcagccagtg
acttcctctgtcaaagacagcagctttgtggaaaagatgaagaagacgggcaggaacatt
attgtgttctatggttcccagacggggacagcggaggagtttgccaaccgcttgtccaag
gacgcccaccgttacgggatgcggggcatggctgcagaccctgaggagtatgacctgggc
gacctgggcagcctgccggagattgagaactctctggcagtgttctgcatggccacctat
ggtgagggagaccccacggacaatgcccaggacttctacgactggctccaggagactgac
gtggatctctctggagtcaagtatgcggtgtttggtcttgggaacaagacctatgagcac
ttcaatgccatgggcaagtacgtggacaagcggctggagcagctcggcgcccagcggatc
tttgagctggggatgggcgatgatgatgggaacctggaggaggacttcatcacatggcga
gagcagttctggccggccgtgtgcgagcactttggggtggaagccactggagaagagtcc
agcattcgccagtatgagcttgtggtccacacagacctagacccggccaaggtgtacgtg
ggagagatgggccgactgaagagctacgagaaccagaaaccccccttcgatgccaagaat
ccgttcttggctgcggtcaccaccaaccggaagctgaaccagggaacggagcgccacctc
atgcacctggaattagacatctcggactccaaactcaggtatgaatctggggaccatgtg
gccgtttacccagccaatgactctaccctggtcagccagctcggcgagatcctgggtgcc
gacctggacgtcgtcatgtccctgaacaatctcgatgaggagtccaacaagaagcacccc
ttcccctgccctacctcctaccgcacggccctcacctactacctggacatcaccaacccg
cctcgcaccaatgtgctctacgagctggcccagtacgcctccgagccctcggagcaggag
cagctgcgcaagatggcctcctcctcgggcgagggcaaggagctgtacctgagctgggtg
gtggaggcccggaggcacatcctggccatcctgcaggactacccgtccctgcggcccccc
atcgacgcccagcctgtggagctgctgccccggctgcaggcccgctactactccatcgcc
tcgtcctccaaggtccaccccaactccgtgcacatctgtgcggtggccgtggagtacgag
accaagtcgggccgcgtcaacaagggcgtggccaccagctggctgcgggccaaggagccc
gcgggggagaacggccgccgggcgctggtgcccatgttcgtgcgcaagtcccagttccgc
ctgcccttcaaggccaccacaccggtcatcatggtgggccccggcaccggcgtggccccc
ttcatcggcttcatccaggagcgcgcctggctgcggcagcagggcaaagaggtgggggag
acgctgctgtactacgggtgccgccgctccgacgaggactacctgtaccgcgaggagctg
gccgccttccaccgggacggctccctcacccagctcaacgtggccttttcacgggagcag
ccccacaaggtctacgtgcagcacttactgaagagggacaaggagcacctgtggcagctg
atccacgagggcggcgcccacatctacgtctgcggggatgctcggaacatggcgagggac
gtgcagaacaccttctacgacatcgtggccgagggggggaccatggcgcatgcccaggcc
gtggactacatcaagaagctgatgaccaagggccgctactctctggacgtgtggagctag

DBGET integrated database retrieval system