KEGG   Ailuropoda melanoleuca (giant panda): 100465011Help
Entry
100465011         CDS       T01329                                 

Gene name
POR
Definition
(RefSeq) P450 (cytochrome) oxidoreductase
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100465011 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 717 aa AA seqDB search
MTCVFAKLGFQWLFGPNYFVNGAVRHSCGPGDTMFPVNMGDSSMDASTTVSETVAEEVSL
FSMTDMILFSLIVGVLTYWLLFRKKKDEIPEFTKIQPVTSSVKDSSFVEKMKKTGRNIIV
FYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLGDLGSLPEIENSLAVFCMATYGE
GDPTDNAQDFYDWLQETDVDLSGVKYAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFE
LGMGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDLDPAKVYVGE
MGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKLRYESGDHVAV
YPANDSTLVSQLGEILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPR
TNVLYELAQYASEPSEQEQLRKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPID
AQPVELLPRLQARYYSIASSSKVHPNSVHICAVAVEYETKSGRVNKGVATSWLRAKEPAG
ENGRRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGETL
LYYGCRRSDEDYLYREELAAFHRDGSLTQLNVAFSREQPHKVYVQHLLKRDKEHLWQLIH
EGGAHIYVCGDARNMARDVQNTFYDIVAEGGTMAHAQAVDYIKKLMTKGRYSLDVWS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgacttgtgtctttgccaagctgggttttcagtggttgttcggacctaactacttcgta
aatggagctgttaggcattcctgtgggcctggggacaccatgtttcctgtcaacatgggg
gactccagcatggatgccagcaccaccgtgtctgagacagtggcagaagaagtgtctctc
ttcagtatgacggacatgattctgttttccctcatcgtgggcgtcctgacctactggctc
ctcttcagaaagaaaaaagacgaaatcccggagttcaccaaaattcagccagtgacttcc
tctgtcaaagacagcagctttgtggaaaagatgaagaagacgggcaggaacattattgtg
ttctatggttcccagacggggacagcggaggagtttgccaaccgcttgtccaaggacgcc
caccgttacgggatgcggggcatggctgcagaccctgaggagtatgacctgggcgacctg
ggcagcctgccggagattgagaactctctggcagtgttctgcatggccacctatggtgag
ggagaccccacggacaatgcccaggacttctacgactggctccaggagactgacgtggat
ctctctggagtcaagtatgcggtgtttggtcttgggaacaagacctatgagcacttcaat
gccatgggcaagtacgtggacaagcggctggagcagctcggcgcccagcggatctttgag
ctggggatgggcgatgatgatgggaacctggaggaggacttcatcacatggcgagagcag
ttctggccggccgtgtgcgagcactttggggtggaagccactggagaagagtccagcatt
cgccagtatgagcttgtggtccacacagacctagacccggccaaggtgtacgtgggagag
atgggccgactgaagagctacgagaaccagaaaccccccttcgatgccaagaatccgttc
ttggctgcggtcaccaccaaccggaagctgaaccagggaacggagcgccacctcatgcac
ctggaattagacatctcggactccaaactcaggtatgaatctggggaccatgtggccgtt
tacccagccaatgactctaccctggtcagccagctcggcgagatcctgggtgccgacctg
gacgtcgtcatgtccctgaacaatctcgatgaggagtccaacaagaagcaccccttcccc
tgccctacctcctaccgcacggccctcacctactacctggacatcaccaacccgcctcgc
accaatgtgctctacgagctggcccagtacgcctccgagccctcggagcaggagcagctg
cgcaagatggcctcctcctcgggcgagggcaaggagctgtacctgagctgggtggtggag
gcccggaggcacatcctggccatcctgcaggactacccgtccctgcggccccccatcgac
gcccagcctgtggagctgctgccccggctgcaggcccgctactactccatcgcctcgtcc
tccaaggtccaccccaactccgtgcacatctgtgcggtggccgtggagtacgagaccaag
tcgggccgcgtcaacaagggcgtggccaccagctggctgcgggccaaggagcccgcgggg
gagaacggccgccgggcgctggtgcccatgttcgtgcgcaagtcccagttccgcctgccc
ttcaaggccaccacaccggtcatcatggtgggccccggcaccggcgtggcccccttcatc
ggcttcatccaggagcgcgcctggctgcggcagcagggcaaagaggtgggggagacgctg
ctgtactacgggtgccgccgctccgacgaggactacctgtaccgcgaggagctggccgcc
ttccaccgggacggctccctcacccagctcaacgtggccttttcacgggagcagccccac
aaggtctacgtgcagcacttactgaagagggacaaggagcacctgtggcagctgatccac
gagggcggcgcccacatctacgtctgcggggatgctcggaacatggcgagggacgtgcag
aacaccttctacgacatcgtggccgagggggggaccatggcgcatgcccaggccgtggac
tacatcaagaagctgatgaccaagggccgctactctctggacgtgtggagctag

DBGET integrated database retrieval system