KEGG   Ailuropoda melanoleuca (giant panda): 100465091Help
Entry
100465091         CDS       T01329                                 

Definition
cytochrome P450 2A13-like
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:aml00980]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:aml05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 494 aa AA seqDB search
MLTSGLLLVALLTCLTVMALMSVWRQKKLGGKLPPGPTPLPFLGNYLQLNTQQMYNSLMK
LRERYGPVFTVHVGPRRIVVLCGHEVVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIEALRDTRGAFLDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQLYEMFYSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEQNQRTLDPNSPRDFIDSFLIRMQEEQNNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKHPDVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDIIPMGVARRVTKDTGFREFLLPKGTEVFPMLGSVLRDPKFFSNPQDFHPQHFLDEN
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNILQNFRFKSPQLPKDIDVSPKLVGF
ATIPRNYTMSFQPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgacctcagggctgcttctggtggctttgctcacctgcctgacagtaatggccttg
atgtctgtctggaggcagaagaaactcggggggaagctccctccaggacccaccccgttg
cctttcctcgggaactacctgcagctgaacacacagcagatgtacaactctctcatgaag
ctcagggagcgctatggcccggtgttcacggtccacgtgggaccccggcgcatcgtggtg
ctgtgtggacacgaggtggtgaaggaggctctggtggaccaggctgaggaattcagcggg
cgaggtgaacaggccaccttcgactggctcttcaaaggctatggcgtggcgttcagcaat
ggggagcgcgccaagcagctccggcgcttctccatcactacgctgcgggactttggagtg
ggcaagcgcggcattgaggagcgcatccaggaggaggcgggcttcctcatcgaggccctc
cgggacacgcgtggtgccttcctcgatcccaccttcttcctgagccgaacagtgtccaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgctgcgtatgatgctgggaagcttccagttcacagctacctctatggggcagctctat
gagatgttctattcagtgatgaaacacctgccaggaccacagcaacaggcatttaaggag
ctgcagggtctggaggatttcatagccaagaaggtggagcagaaccaacgcaccctggac
cccaactcaccgagggacttcatcgactccttcctcatccgcatgcaggaggagcagaac
aaccccaacacggagttctacatgaagaacctggtgctgaccacactgaacctcttcttt
gcgggcaccgagacggtcagcacaaccctgcggtacgggttcctgctgctcatgaagcac
ccagatgtggaggccaaggtccatgaggagattgaccgagtgattggcaagaaccgtcag
cccaagttcgaggatcgggccaagatgccctacacagaggcagtgatccacgagatccaa
agatttggagacataatccccatgggcgtggcccgcagagtcaccaaagacaccgggttt
cgagagttcctcctccccaaggggaccgaagtgttccctatgctgggctccgtgctgaga
gaccccaagttcttctccaacccccaagactttcacccccagcacttcctggatgagaat
gggcagtttaagaagagtgatgcttttgtgcccttctccattggaaagcggtactgtttt
ggagaaggcctggctagaatggagctctttctcttcctcaccaacatcttgcagaacttc
cgcttcaagtccccgcagctgcccaaagacatcgacgtgtcccccaagctcgtgggcttt
gctaccatcccacgaaattacaccatgagcttccagcctcgctga

DBGET integrated database retrieval system