KEGG   Ailuropoda melanoleuca (giant panda): 100465239Help
Entry
100465239         CDS       T01329                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100465239
  Energy metabolism
   00920 Sulfur metabolism
    100465239
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100465239
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100465239
    3.1.3.25  inositol-phosphate phosphatase
     100465239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 333 aa AA seqDB search
MTAKPLGNVEVRPTGQLRSRDRAARGAWARGTATVGFLAWIGLSREGAMGRAGAVRRVRE
SNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTSFPNVQINTEEHVDAADQEVILW
DHKIPEDILKEIATPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGV
IHKPFSEYTAWAMVDGGSNVKARTSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPA
GGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLNGEEISYT
GSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaagccgttgggtaacgtggaagtgagacccactggccagctgaggagccgg
gaccgcgctgcccggggcgcttgggcgcgcggcacggcgacggtgggcttcttggcttgg
atcggcctttcccgggagggagcgatggggcgcgcgggcgccgtgaggcgcgtccgcgag
agcaacgtcctccacgagaagtccaaggggaagacgcgcgagggagccgaggacaagatg
accagcggggacgtgctgtccaaccgcaagatgttctacctgctcaagaccagcttccct
aacgtgcagataaatactgaggaacatgtggatgcagctgatcaagaggttatcttatgg
gatcataagattcctgaggacatcctgaaggaaatagccacccctaaagaggtaccggca
gaaagtgttactgtctggatcgatccacttgatgctacacaggaatatacagaggatctt
cgaaagtatgtcactactatggtatgtgtggctgtgaatggtaaacctgtgctaggagtg
atacataagccattttctgaatatacagcttgggcaatggtagacggtgggtccaatgtg
aaagcccgaacttcctacaatgagaagactccaaggatagttgtgtcacgctcccattcg
ggaatggtcaaacaggttgctcttcagacttttggaaaccagactacaattatcccagct
ggtggtgctggttataaagttttagcactcttggatgtgcctgataagagtcaagaaaaa
gctgatctatatatccatgtgacatacatcaaaaaatgggatatatgtgccggcaatgcc
atcttaaaagcccttggggggcatatgactaccctgaatggtgaagaaatcagttacact
ggttccgacggcattgaaggagggctccttgctagcatcagaatgaaccaccaagctctg
gtcagaaaactcccagatctagagaagacaggacataaataa

DBGET integrated database retrieval system