KEGG   Ailuropoda melanoleuca (giant panda): 100465239Help
Entry
100465239         CDS       T01329                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aml00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aml00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aml04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 333 aa AA seqDB search
MTAKPLGNVEVRPTGQLRSRDRAARGAWARGTATVGFLAWIGLSREGAMGRAGAVRRVRE
SNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTSFPNVQINTEEHVDAADQEVILW
DHKIPEDILKEIATPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGV
IHKPFSEYTAWAMVDGGSNVKARTSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPA
GGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLNGEEISYT
GSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaagccgttgggtaacgtggaagtgagacccactggccagctgaggagccgg
gaccgcgctgcccggggcgcttgggcgcgcggcacggcgacggtgggcttcttggcttgg
atcggcctttcccgggagggagcgatggggcgcgcgggcgccgtgaggcgcgtccgcgag
agcaacgtcctccacgagaagtccaaggggaagacgcgcgagggagccgaggacaagatg
accagcggggacgtgctgtccaaccgcaagatgttctacctgctcaagaccagcttccct
aacgtgcagataaatactgaggaacatgtggatgcagctgatcaagaggttatcttatgg
gatcataagattcctgaggacatcctgaaggaaatagccacccctaaagaggtaccggca
gaaagtgttactgtctggatcgatccacttgatgctacacaggaatatacagaggatctt
cgaaagtatgtcactactatggtatgtgtggctgtgaatggtaaacctgtgctaggagtg
atacataagccattttctgaatatacagcttgggcaatggtagacggtgggtccaatgtg
aaagcccgaacttcctacaatgagaagactccaaggatagttgtgtcacgctcccattcg
ggaatggtcaaacaggttgctcttcagacttttggaaaccagactacaattatcccagct
ggtggtgctggttataaagttttagcactcttggatgtgcctgataagagtcaagaaaaa
gctgatctatatatccatgtgacatacatcaaaaaatgggatatatgtgccggcaatgcc
atcttaaaagcccttggggggcatatgactaccctgaatggtgaagaaatcagttacact
ggttccgacggcattgaaggagggctccttgctagcatcagaatgaaccaccaagctctg
gtcagaaaactcccagatctagagaagacaggacataaataa

DBGET integrated database retrieval system