KEGG   Ailuropoda melanoleuca (giant panda): 100465345Help
Entry
100465345         CDS       T01329                                 

Definition
(RefSeq) cytochrome P450 2F5
  KO
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100465345
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100465345
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100465345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 498 aa AA seqDB search
MPAAAFTMDSLSVAILLGLLALTCLFLILSSRGKGQLPPGPRPLPFLGNLLQLRSQDMLT
SLTKLSKKYGSMYTVHLGPRRVVVLSGYQAVKEALVDQGEDFSGRGDYPVFFNFTKGNGI
AFSNGDRWKVLRKFSVQILHNFGMGKRSIEEQILEEGSFLLAELRKTEGKPFDPTFVLSR
SVSNIICSVIFGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYNIFPGLLDWVPGPHRR
LFRNYGCMKDLIARSVRDHQDSLDPSSPRDFIDCFLNKMAQEKQDPHSHFHMDTLLMTTH
NLLFGGTETVGTTLRHAFLVLMKYPKVQARVQEEIDSVVGRARLPALEDRTAMPYTDAVI
HEVQRFADVIPMNLPHRVTRDTAFRGFLIPKGTDIITLLNTVHYDPSQFLTPQEFNPEHF
LDANQSFKKNPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIDLTPL
SSGLGNLPRPFQLCVLTR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagctgctttcaccatggacagtctgagcgtagccatcttgctcggcctcctg
gctctcacctgtctgttcctgatcctcagttcaaggggcaaaggtcagctgcccccaggc
cccaggcccctcccattcctgggaaacctgctgcagcttcgctcccaagacatgctgacc
tctctcaccaagctgagcaagaagtatggctcaatgtacacagtgcacctgggacccagg
cgcgtggtggtcctcagcgggtaccaagctgtgaaggaggcccttgtggaccaaggggag
gattttagtggccgtggcgattaccctgtctttttcaacttcactaagggcaatggcatc
gccttctccaatggggaccggtggaaggtcctgaggaagttctctgtccagattctgcac
aactttgggatggggaagaggagcattgaggagcagatcctggaggaaggcagcttcctg
ctggcagagctaaggaaaactgaaggcaagcccttcgaccccacatttgtgctcagccgc
tccgtgtccaacattatctgctctgtgatcttcggcagccgctttgactacgacgatgag
cgtctgctcaccattatccgcctcatcaatgacaacttccaaatcatgagcagcccctgg
ggagagttgtacaacatctttccgggcctcctggactgggtacccggaccgcaccgacgc
cttttccggaactacgggtgcatgaaggacctcatcgcccgcagcgtccgcgaccaccag
gactccctcgaccccagctctccccgggacttcattgattgcttcctcaacaagatggca
caagagaagcaggacccgcacagccacttccacatggacaccctgctgatgaccacacat
aacctgctctttggtggcaccgagaccgtgggcaccaccctgcgccacgccttccttgta
ctcatgaagtacccaaaagttcaagcccgcgtacaggaggagatcgacagcgtggtgggt
cgcgcgcggctgccggcgctggaggaccgaacggccatgccttacacagacgcggtgatc
cacgaggtgcagcgcttcgcagacgtcatccccatgaacttgccgcaccgcgtcactcgg
gacacagcctttcgtggcttcctgatacccaagggcacagatatcatcacccttcttaac
acagtccattatgaccccagccagttcctgacgccccaggaattcaaccctgagcatttt
ctggatgccaatcaatccttcaagaagaaccctgccttcatgcctttctcagctggtcgc
cgactgtgcctgggcgagtcgctggcgcgcatggagctcttcctctacctcaccgccatc
ctgcagagcttctcgctgcagccgctgggggcgcccgaggacatcgacctgacgccgctc
agctccgggctcggcaacttaccgcggcctttccagctgtgcgtgctcacgcgctga

DBGET integrated database retrieval system