KEGG   Ailuropoda melanoleuca (giant panda): 100465384Help
Entry
100465384         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 606 aa AA seqDB search
MSQLSSTLKRYTESARYTDVPYAKSGYGTYTPSSYGANLAASFLEKEKLGFKPGPPTSFL
TRPRTYGPSSILDYDRGRPLLRPDIIGGSKRAESQTRGPERPSGSGLSGGSGFPYGVTNS
SLSYLPVPARDQGGTLTQKKSNSQSDLARDFSSLRTSDSYQIDPGNLGRSPMLAHTRKEL
CALQGLYQAASRSEYLTDYLENYGRKSSAPQMPTQAPPSRVPEVLSPTYRPSGRYTLWEK
NKVQAPGSSRSSSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRL
YMRDLSHSSNVHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQ
EFLRFLLDGLHNEVNRVTVRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQL
KSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRC
RARKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHA
VYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELA
SPPSRM
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccaccctgaagcgctacacagaatcggcccgctacacagatgtg
ccttatgccaaatcgggctatggcacctacactccctcttcctacggggccaacctggct
gcctccttcctggagaaagagaagcttggttttaagccaggccccccaaccagcttcctc
acccgtccccgtacctatggtccctcctccatcctggactatgacaggggccgccccttg
ctgagacccgacatcatcgggggtagtaagcgggccgagagccagactcggggccctgag
aggccttcagggagtggactcagcgggggcagtggattcccttatggagtgaccaacagc
tccctcagctacctgcctgtgcctgcccgcgaccagggtggaaccctgacccaaaagaag
tccaacagtcaatcagacctggcccgggatttctccagcctccggacctcagatagctac
cagatagaccctgggaacctgggccgcagccccatgttggcccacacccgcaaggagctg
tgtgccctgcaggggctctatcaggcagccagccgctcggagtacctgaccgactacctg
gaaaactatggtcgaaagagcagtgcacctcagatgcccacccaggcccctccctcacga
gtccctgaagtcctcagccccacctaccgacccagtggccgttacactctgtgggagaag
aacaaggtccaggcccctgggtccagccgctccagctccccagggcgagacaccatgaat
tctaagagcgcccagggtctggctggtcttcgaaaccttgggaacacgtgcttcatgaac
tccattctgcagtgcctgagcaacacccgggagctgagggattactgcctccagaggctc
tatatgcgggacctcagccacagcagcaatgtacacacggccctcatggaagagttcgca
aaactaatccagaccatatggacttcatcccccaatgatgtggtgagcccctctgagttc
aagacccagatccagagatatgcgccacgcttcgttggctataatcagcaagatgctcag
gagtttcttcgctttcttctggatgggctccacaacgaggtgaaccgagtgacggtgagg
cccaagtccaaccctgagaacctcgatcatcttcctgatgatgaaaaaggacgacagatg
tggaggaaatatctagaacgggaagatagtcggattggggatctcttcgttgggcagcta
aagagctccctgacatgtactgactgtggttactgctctacagtctttgatcccttctgg
gacctctcactgcccatcgctaagcgaggttaccctgaggtaactttaatggactgcatg
aggctcttcaccaaagaggatgtgctcgatggagatgaaaagccgacatgctgtcgctgc
cgagccagaaaacgatgtataaagaagttctccatccagaggttcccaaagatcttggtg
ctccatctgaagcggttctcagaatccaggatacgaaccagcaagctcacaacatttgtg
aatttcccattaagagacctggacttgagagaatttgcctcagaaaacaccaaccacgct
gtttacaacctgtacgctgtgtccaatcactctggaaccaccatgggcggccattataca
gcctactgccggagcccagtgacaggcgaatggcacactttcaatgactctagcgtcaca
cccatgtcctccagccaagtgcgcaccagcgacgcctatctgctcttctatgaattggcc
agtccaccctcccgcatgtag

DBGET integrated database retrieval system