KEGG   Ailuropoda melanoleuca (giant panda): 100465399Help
Entry
100465399         CDS       T01329                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aml00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 463 aa AA seqDB search
MLLLLLLGLRPQLVLGIIPVEEEDADFWNRQAAQALDTAKKLEPIQTAAKNLILFLGDGM
GVPTVTATRILKGQLNDKLGPETPLAMDHFPYLALSKTYNVDRQVPDSAATATAYLCGVK
ANYQTIGVSAAARWNQCNTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHVV
NRNWYSDADMPAKAREEGCQDIAQQLISNMDIDVILGGGRKYMFPQGTPDPEYPSDAGQD
GVRLDGRNLVQEWQAKYQGARYVWNRTALIEASQDPSVTHLMGLFEPGDTKYEVRRDTTQ
DPSLMEMTEVAVRLLSRNPRGFYLFVEGGRIDHGHHDGTAYLALTEAVMFDSAIDKASQI
TSEKDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSIAQDNKTYTSILYGNGPGGSFALL
GISRPNVSDSTLLAKEAAGARVRYHPPWAPPGAQRYYYTERRC
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgctgctgggtctgaggccacagctggtccttggcatcattccagtc
gaggaggaggacgcagacttctggaaccgccaggcggcgcaggccctggacactgctaag
aagctggagcccatccagacggctgctaagaacctcattctcttcttgggggacgggatg
ggggtgcccacagtgacagccactcggatcctaaaagggcaacttaatgacaaactggga
cctgagacacccctggccatggaccactttccgtacctggctctgtccaagacatacaac
gtggacagacaggtgccagacagcgcagcgacagccacggcctacctgtgcggggtcaag
gccaactaccagaccattggtgtgagcgcagctgcccgctggaaccagtgcaacacgaca
cgtggcaatgaggtcacttccgtgatgaaccgggccaagaaagcagggaagtcggtgggg
gtggtgaccaccacgagagtgcagcacgcctcgccggctggcacctatgcacacgtagtg
aaccgcaactggtactcggacgccgacatgcctgccaaggcgcgggaggagggatgccag
gacatcgcccagcagctcatctccaacatggacattgatgtgatcctgggtggaggccga
aagtacatgttcccccaggggactccagaccctgagtatccaagtgacgctggacaggat
ggagtcaggttggatgggcggaacctggtgcaggagtggcaggccaagtaccagggtgcc
cggtatgtgtggaatcgcacggcgctcattgaggcatcccaggacccctctgtaacacac
ctcatgggcctctttgagccaggagacaccaagtatgaagtccgccgagacaccacccag
gacccgtccctgatggagatgacagaggtggccgtgcgcctgctgagccggaacccccgt
ggtttctacctcttcgtggagggaggccgcatcgaccacggtcatcacgacggcacggct
tatctggccctgacggaggctgtcatgttcgattctgccatcgacaaggccagccagatc
acaagtgagaaggacacactgactcttgtcaccgctgaccactctcatgtcttctctttt
ggtggctacacactgcgagggagctccattttcggactggcccccagcatagcccaagac
aacaagacctacacctctatcctttacggcaacggccccggcggcagcttcgcgctctta
gggatctcccggcccaacgtcagcgacagcaccttgctggctaaggaggctgctggggcc
agggtgcggtaccatccaccctgggctcctccgggggcccagcggtactattacacagag
aggagatgctga

DBGET integrated database retrieval system