KEGG   Ailuropoda melanoleuca (giant panda): 100465476Help
Entry
100465476         CDS       T01329                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04015  Rap1 signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04611  Platelet activation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04670  Leukocyte transendothelial migration
aml04714  Thermogenesis
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05014  Amyotrophic lateral sclerosis (ALS)
aml05132  Salmonella infection
aml05133  Pertussis
aml05140  Leishmaniasis
aml05142  Chagas disease (American trypanosomiasis)
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05164  Influenza A
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05205  Proteoglycans in cancer
aml05418  Fluid shear stress and atherosclerosis
Module
aml_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100465476 (MAPK14)
   04010 MAPK signaling pathway
    100465476 (MAPK14)
   04370 VEGF signaling pathway
    100465476 (MAPK14)
   04668 TNF signaling pathway
    100465476 (MAPK14)
   04068 FoxO signaling pathway
    100465476 (MAPK14)
   04071 Sphingolipid signaling pathway
    100465476 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100465476 (MAPK14)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100465476 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100465476 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100465476 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100465476 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100465476 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100465476 (MAPK14)
   04660 T cell receptor signaling pathway
    100465476 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100465476 (MAPK14)
   04659 Th17 cell differentiation
    100465476 (MAPK14)
   04657 IL-17 signaling pathway
    100465476 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100465476 (MAPK14)
   04670 Leukocyte transendothelial migration
    100465476 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    100465476 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100465476 (MAPK14)
   04917 Prolactin signaling pathway
    100465476 (MAPK14)
   04926 Relaxin signaling pathway
    100465476 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100465476 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    100465476 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100465476 (MAPK14)
   04722 Neurotrophin signaling pathway
    100465476 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100465476 (MAPK14)
  Development
   04380 Osteoclast differentiation
    100465476 (MAPK14)
  Environmental adaptation
   04714 Thermogenesis
    100465476 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100465476 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100465476 (MAPK14)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100465476 (MAPK14)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100465476 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    100465476 (MAPK14)
   05133 Pertussis
    100465476 (MAPK14)
   05152 Tuberculosis
    100465476 (MAPK14)
   05164 Influenza A
    100465476 (MAPK14)
   05160 Hepatitis C
    100465476 (MAPK14)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100465476 (MAPK14)
   05169 Epstein-Barr virus infection
    100465476 (MAPK14)
   05145 Toxoplasmosis
    100465476 (MAPK14)
   05140 Leishmaniasis
    100465476 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    100465476 (MAPK14)
  Drug resistance
   01522 Endocrine resistance
    100465476 (MAPK14)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100465476 (MAPK14)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100465476 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 100465476
NCBI-ProteinID: XP_002914341
Ensembl: ENSAMEG00000000425
Position
Un
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPEDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaatctgtccccggtgggctccggtgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtggcagtgaagaagctctccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcaac
gatgtgtatctggtgacccatctcatgggagcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttcctcatctaccagattctccgaggtctcaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggattttggactggcccgacatacagatgatgaaatgaca
ggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaattacattcag
tctttgacccagatgccgaaaatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagacaagagaattacggcagcc
caagccctcgcacacgcctactttgctcagtaccacgaccctgaggatgaaccagtggct
gatccttacgatcagtcctttgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggaatcc
tga

DBGET integrated database retrieval system