KEGG   Ailuropoda melanoleuca (giant panda): 100465559Help
Entry
100465559         CDS       T01329                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100465559
  Replication and repair
   03420 Nucleotide excision repair
    100465559
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100465559
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100465559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKPKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttcgccagtgaggagcagttggca
cgactgcgggcagacgccaaccgcaaattcaagtgcaaagcggtggccaacgggaaggtt
cttccaaatgatccagtctttcttgagcctcatgaagaaatgatactttgcaaatactat
gagaagagattattagaattctgttcagtgtttaagccagcaatgccaaggtctgtcgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
ccccggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccgcagttcgttggaaatctgcgggagagtcctcttggacaagaaaaggcactt
gaacagattttggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccgtttgagggctttctcattgatttaaagactcgctatcccatg
atggagaatccagagatgttgaggaaaacagctgatgactttcttaatagaattgcattg
acagatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcatctcgagcaggaattactatggaaagttatttgtcagaaagtctgatgctgaaagag
aacagaacttgcttgtcgcagttactagatataatgaaaagtatgagaaacttggtaaaa
aaatacgagcctcccagatctgaagaagttgctgttctgaaacagaagttggagagatgt
cactctgctgagcttgcccttaacgtaattacgaagaagaggaaaggctatgaagatgat
gattatgtctcaaagaaacccaaacatgaagaggaagaatggactgacgacgacctggta
gattctctctaa

DBGET integrated database retrieval system