KEGG   Ailuropoda melanoleuca (giant panda): 100465559Help
Entry
100465559         CDS       T01329                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  
cyclin H
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100465559 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100465559 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100465559 (CCNH)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100465559 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKPKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttcgccagtgaggagcagttggca
cgactgcgggcagacgccaaccgcaaattcaagtgcaaagcggtggccaacgggaaggtt
cttccaaatgatccagtctttcttgagcctcatgaagaaatgatactttgcaaatactat
gagaagagattattagaattctgttcagtgtttaagccagcaatgccaaggtctgtcgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
ccccggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccgcagttcgttggaaatctgcgggagagtcctcttggacaagaaaaggcactt
gaacagattttggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccgtttgagggctttctcattgatttaaagactcgctatcccatg
atggagaatccagagatgttgaggaaaacagctgatgactttcttaatagaattgcattg
acagatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcatctcgagcaggaattactatggaaagttatttgtcagaaagtctgatgctgaaagag
aacagaacttgcttgtcgcagttactagatataatgaaaagtatgagaaacttggtaaaa
aaatacgagcctcccagatctgaagaagttgctgttctgaaacagaagttggagagatgt
cactctgctgagcttgcccttaacgtaattacgaagaagaggaaaggctatgaagatgat
gattatgtctcaaagaaacccaaacatgaagaggaagaatggactgacgacgacctggta
gattctctctaa

DBGET integrated database retrieval system