KEGG   Ailuropoda melanoleuca (giant panda): 100465559Help
Entry
100465559         CDS       T01329                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:aml03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aml03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:aml04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMILCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKPKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttcgccagtgaggagcagttggca
cgactgcgggcagacgccaaccgcaaattcaagtgcaaagcggtggccaacgggaaggtt
cttccaaatgatccagtctttcttgagcctcatgaagaaatgatactttgcaaatactat
gagaagagattattagaattctgttcagtgtttaagccagcaatgccaaggtctgtcgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
ccccggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccgcagttcgttggaaatctgcgggagagtcctcttggacaagaaaaggcactt
gaacagattttggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccgtttgagggctttctcattgatttaaagactcgctatcccatg
atggagaatccagagatgttgaggaaaacagctgatgactttcttaatagaattgcattg
acagatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcatctcgagcaggaattactatggaaagttatttgtcagaaagtctgatgctgaaagag
aacagaacttgcttgtcgcagttactagatataatgaaaagtatgagaaacttggtaaaa
aaatacgagcctcccagatctgaagaagttgctgttctgaaacagaagttggagagatgt
cactctgctgagcttgcccttaacgtaattacgaagaagaggaaaggctatgaagatgat
gattatgtctcaaagaaacccaaacatgaagaggaagaatggactgacgacgacctggta
gattctctctaa

DBGET integrated database retrieval system